KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_3313Help
Entry
ECBD_3313         CDS       T00939                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00052  Galactose metabolism
ebd00511  Other glycan degradation
ebd00600  Sphingolipid metabolism
ebd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECBD_3313
  Lipid metabolism
   00600 Sphingolipid metabolism
    ECBD_3313
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ECBD_3313
Enzymes [BR:ebd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ECBD_3313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Bgal_small_N DUF4981 Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: ACT30313
UniProt: A0A140NDI2
Structure
PDB: 

Position
3446544..3449618
Genome map
AA seq 1024 aa AA seqDB search
MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR
FAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENP
TGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRA
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAV
LEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPK
LWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEH
HPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD
PSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALD
GKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQ
WRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTP
LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTA
HAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLG
LGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI
SRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLV
WCQK
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgattacggattcactggccgtcgttttacaacgtcgtgactgggaaaaccct
ggcgttacccaacttaatcgccttgcagcacatccccctttcgccagctggcgtaatagc
gaagaggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcgaatggcgc
tttgcctggtttccggcaccagaagcggtgccggaaagctggctggagtgcgatcttcct
gaggccgatactgtcgtcgtcccctcaaactggcagatgcacggttacgatgcgcccatc
tacaccaacgtgacctatcccattacggtcaatccgccgtttgttcccacggagaatccg
acgggttgttactcgctcacatttaatgttgatgaaagctggctacaggaaggccagacg
cgaattatttttgatggcgttaactcggcgtttcatctgtggtgcaacgggcgctgggtc
ggttacggccaggacagtcgtttgccgtctgaatttgacctgagcgcatttttacgcgcc
ggagaaaaccgcctcgcggtgatggtgctgcgctggagtgacggcagttatctggaagat
caggatatgtggcggatgagcggcattttccgtgacgtctcgttgctgcataaaccgact
acacaaatcagcgatttccatgttgccactcgctttaatgatgatttcagccgcgctgta
ctggaggctgaagttcagatgtgcggcgagttgcgtgactacctacgggtaacagtttct
ttatggcagggtgaaacgcaggtcgccagcggcaccgcgcctttcggcggtgaaattatc
gatgagcgtggtggttatgccgatcgcgtcacactacgtctgaacgtcgaaaacccgaaa
ctgtggagcgccgaaatcccgaatctctatcgtgcggtggttgaactgcacaccgccgac
ggcacgctgattgaagcagaagcctgcgatgtcggtttccgcgaggtgcggattgaaaat
ggtctgctgctgctgaacggcaagccgttgctgattcgaggcgttaaccgtcacgagcat
catcctctgcatggtcaggtcatggatgagcagacgatggtgcaggatatcctgctgatg
aagcagaacaactttaacgccgtgcgctgttcgcattatccgaaccatccgctgtggtac
acgctgtgcgaccgctacggcctgtatgtggtggatgaagccaatattgaaacccacggc
atggtgccaatgaatcgtctgaccgatgatccgcgctggctaccggcgatgagcgaacgc
gtaacgcgaatggtgcagcgcgatcgtaatcacccgagtgtgatcatctggtcgctgggg
aatgaatcaggccacggcgctaatcacgacgcgctgtatcgctggatcaaatctgtcgat
ccttcccgcccggtgcagtatgaaggcggcggagccgacaccacggccaccgatattatt
tgcccgatgtacgcgcgcgtggatgaagaccagcccttcccggctgtgccgaaatggtcc
atcaaaaaatggctttcgctacctggagagacgcgcccgctgatcctttgcgaatacgcc
cacgcgatgggtaacagtcttggcggtttcgctaaatactggcaggcgtttcgtcagtat
ccccgtttacagggcggcttcgtctgggactgggtggatcagtcgctgattaaatatgat
gaaaacggcaacccgtggtcggcttacggcggtgattttggcgatacgccgaacgatcgc
cagttctgtatgaacggtctggtctttgccgaccgcacgccgcatccagcgctgacggaa
gcaaaacaccagcagcagtttttccagttccgtttatccgggcaaaccatcgaagtgacc
agcgaatacctgttccgtcatagcgataacgagctcctgcactggatggtggcgctggat
ggtaagccgctggcaagcggtgaagtgcctctggatgtcgctccacaaggtaaacagttg
attgaactgcctgaactaccgcagccggagagcgccgggcaactctggctcacagtacgc
gtagtgcaaccgaacgcgaccgcatggtcagaagccggacacatcagcgcctggcagcag
tggcgtctggctgaaaacctcagcgtgacactccccgccgcgtcccacgccatcccgcat
ctgaccaccagcgaaatggatttttgcatcgagctgggtaataagcgttggcaatttaac
cgccagtcaggctttctttcacagatgtggattggcgataaaaaacaactgctgacgccg
ctgcgcgatcagttcacccgtgcaccgctggataacgacattggcgtaagtgaagcgacc
cgcattgaccctaacgcctgggtcgaacgctggaaggcggcgggccattaccaggccgaa
gcagcgttgttgcagtgcacggcagatacacttgctgatgcggtgctgattacgaccgct
cacgcgtggcagcatcaggggaaaaccttatttatcagccggaaaacctaccggattgat
ggtagtggtcaaatggcgattaccgttgatgttgaagtggcgagcgatacaccgcatccg
gcgcggattggcctgaactgccagctggcgcaggtagcagagcgggtaaactggctcgga
ttagggccgcaagaaaactatcccgaccgccttactgccgcctgttttgaccgctgggat
ctgccattgtcagacatgtataccccgtacgtcttcccgagcgaaaacggtctgcgctgc
gggacgcgcgaattgaattatggcccacaccagtggcgcggcgacttccagttcaacatc
agccgctacagtcaacagcaactgatggaaaccagccatcgccatctgctgcacgcggaa
gaaggcacatggctgaatatcgacggtttccatatggggattggtggcgacgactcctgg
agcccgtcagtatcggcggaattccagctgagcgccggtcgctaccattaccagttggtc
tggtgtcaaaaataa

DBGET integrated database retrieval system