KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_4142Help
Entry
ECBD_4142         CDS       T00939                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00010  Glycolysis / Gluconeogenesis
ebd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECBD_4142
Enzymes [BR:ebd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     ECBD_4142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-ProteinID: ACT31125
UniProt: A0A140NHV7
Structure
PDB: 

Position
complement(4359733..4360332)
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEA
LCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGIT
SILVKDKTTIPDYFAKVLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatatcgactttaaccgtgtgctg
ggagcctggagcgatttaacgcgtattccgctggcatcgcttaagaagagttttcatatg
ggggaggcgtttcatcagcatgagcgtggggaaattagcgacgaagcgttcgcagaggcg
ctgtgtcatgagatggctctaccgctaagctacgagcagttctctcacggctggcaggcg
gtgtttgttgcgctgcgcccggaagtgatcgccatcatgcataaactgcgtgagcagggg
catcgcgtggtggtgctttccaataccaaccgcctgcataccaccttctggccggaagaa
tacccggaaattcgtgatgctgctgaccatatctatctgtcgcaagatctggggatgcgc
aaacctgaagcacgaatttaccagcatgttttgcaggcggaaggtttttcacccagcgat
acggtctttttcgacgataacgccgataatatagaaggagccaatcagctgggcattacc
agtattctggtgaaagataaaaccaccatcccggactatttcgcgaaggtgttatgctaa

DBGET integrated database retrieval system