KEGG   Escherichia coli BL21(DE3): B21_00697Help
Entry
B21_00697         CDS       T02096                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1 monomer, subunit of phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00010  Glycolysis / Gluconeogenesis
ebe00260  Glycine, serine and threonine metabolism
ebe00680  Methane metabolism
ebe01100  Metabolic pathways
ebe01110  Biosynthesis of secondary metabolites
ebe01120  Microbial metabolism in diverse environments
ebe01130  Biosynthesis of antibiotics
ebe01200  Carbon metabolism
ebe01230  Biosynthesis of amino acids
Module
ebe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebe_M00002  Glycolysis, core module involving three-carbon compounds
ebe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B21_00697 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    B21_00697 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B21_00697 (gpmA)
Enzymes [BR:ebe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     B21_00697 (gpmA)
Membrane trafficking [BR:ebe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    B21_00697 (gpmA)
Exosome [BR:ebe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   B21_00697 (gpmA)
  Exosomal proteins of melanoma cells
   B21_00697 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: CAQ31214
UniProt: A0A140N9D9
Structure
PDB: 

Position
complement(745245..745997)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcattgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system