KEGG   Escherichia coli BL21(DE3): B21_01012Help
Entry
B21_01012         CDS       T02096                                 

Gene name
agp
Definition
(GenBank) glucose-1-phosphatase / 3-phytase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00010  Glycolysis / Gluconeogenesis
ebe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B21_01012 (agp)
Enzymes [BR:ebe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     B21_01012 (agp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: CAQ31529
UniProt: A0A140NB56
Structure
PDB: 

Position
1069860..1071101
Genome map
AA seq 413 aa AA seqDB search
MNKTLITATVAGIVLLASNAQAQTVPEGYQLQQVLMMSRHNLRAPLANNGSVLEQSTPNK
WPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGMVKSGECPPPDTVYAYANSLQRTVAT
AQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEKAVAAMEKELSKLQLTDS
YQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYY
EGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRT
SAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIE
YVYQSAEQLRNADALTLQAPAQRVTLELSGCPIDANGFCPMDKFDSVLNEAVK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacgctaatcaccgcaactgtggcagggatagttttactcgcttcaaatgct
caggcacaaaccgtaccggaaggctatcagctacagcaagtgctcatgatgagccgccat
aacttacgtgcgccgctggcgaacaatggcagtgtgctggagcagtcgacgccgaataaa
tggccagaatgggacgtccccggtgggcaactcaccaccaaaggtggcgtgctcgaagtg
tatatgggccattacatgcgtgaatggctggcagagcaggggatggtaaaatcgggggaa
tgcccgccgccggacaccgtatatgcctatgccaatagtctgcaacgtaccgttgcgact
gcacagttctttattaccggcgcattcccggggtgtgatattcctgtgcatcaccaggaa
aaaatgggcaccatggacccaacctttaacccggtgatcaccgatgattccgccgcattc
agtgaaaaggcggtggcggcaatggagaaagagctcagcaaactccagcttaccgacagc
taccagctactggaaaaaatcgttaactataaagattcccctgcctgtaaagagaaacaa
cagtgttcgctggtggatggcaaaaatacctttagcgcgaagtatcaacaagaaccaggt
gtttccgggccgctgaaagtcggcaactcgctggtagatgcgtttactttgcaatactac
gaaggttttccgatggatcaggtggcctggggagaaatcaaatctgaccagcagtggaag
gtgttgtcgaagctgaaaaacggttaccaggacagcctgtttacctcaccggaagtggcg
cgcaatgttgcgaaaccgctggtcagttatatcgacaaagctctggtcaccgatcgcacc
agcgcaccgaaaattacagtgttggttgggcacgactccaacattgcctctctgttaacg
gcgctggatttcaaaccgtatcagttgcatgaccagaacgaacgcacgccgattggcggc
aaaatcgttttccagcgttggcatgacagcaaagccaatcgcgatttgatgaaaattgaa
tatgtgtatcagagtgcggaacagttacgtaatgccgatgcgttaaccctgcaggcacct
gctcagcgtgtgacgctggaattaagcggttgcccgatagatgccaacggtttctgcccg
atggataaatttgatagcgtgttgaatgaagcggtgaaataa

DBGET integrated database retrieval system