KEGG   Escherichia coli BL21(DE3): B21_01680Help
Entry
B21_01680         CDS       T02096                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase-2 monomer, subunit of 6-phosphofructokinase II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00010  Glycolysis / Gluconeogenesis
ebe00030  Pentose phosphate pathway
ebe00051  Fructose and mannose metabolism
ebe00052  Galactose metabolism
ebe00680  Methane metabolism
ebe01100  Metabolic pathways
ebe01110  Biosynthesis of secondary metabolites
ebe01120  Microbial metabolism in diverse environments
ebe01130  Biosynthesis of antibiotics
ebe01200  Carbon metabolism
ebe01230  Biosynthesis of amino acids
Module
ebe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B21_01680 (pfkB)
   00030 Pentose phosphate pathway
    B21_01680 (pfkB)
   00051 Fructose and mannose metabolism
    B21_01680 (pfkB)
   00052 Galactose metabolism
    B21_01680 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    B21_01680 (pfkB)
Enzymes [BR:ebe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B21_01680 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: CAQ32197
UniProt: A0A140NB59
Structure
PDB: 

Position
1750777..1751706
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
atccgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcaattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactcacc
cagccggacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttccctgggtccacaaggagcgctgggtgttgatagtgaaaactgtattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggttcgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system