KEGG   Escherichia coli BL21(DE3): B21_02237Help
Entry
B21_02237         CDS       T02096                                 

Gene name
dsdA
Definition
(GenBank) D-serine deaminase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00260  Glycine, serine and threonine metabolism
ebe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B21_02237 (dsdA)
Enzymes [BR:ebe01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     B21_02237 (dsdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NmrA
Motif
Other DBs
NCBI-ProteinID: CAQ32754
UniProt: A0A140N9H2
Structure
PDB: 

Position
2357084..2358412
Genome map
AA seq 442 aa AA seqDB search
MENAKMNSLIAQYPLVKDLVALKETTWFNPGTTSLAEGLPYVGLTEQDVQDAHARLSRFA
PYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISGSIKAR
GGIYEVLAHAEKLALEAGLLTLDDDYSKLLSPEFKQFFSQYSIAVGSTGNLGLSIGIMSA
RIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPNCFFIDDEN
SRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLKLAFGDHVH
CFFAEPTHSPCMLLGVHTGLHDQISVQDIGIDNLTAADGLAVGRASGFVGRAMERLLDGF
YTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVCASVSYQQMHGFSAEQLRNATHL
VWATGGGMVPEEEMNQYLAKGR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgctaaaatgaactcgctcatcgcccagtatccgttggtaaaggatctggtt
gctcttaaagaaaccacctggtttaatcctggcacgacctcattggctgaaggtttacct
tatgttggcctgaccgaacaggatgttcaggacgcccatgcgcgcttatcccgttttgca
ccctatctggcaaaagcatttcctgaaactgctgccactggggggattattgaatcagaa
ctggttgccattccggctatgcaaaaacggctggaaaaggaatatcaacaaccgatcagc
gggcaactgttactgaaaaaagatagccatttgcccatttccggctccataaaagcacgc
ggcgggatttatgaagtcctggcacacgcagaaaaactggctctggaagcggggttgctg
acgcttgatgatgactacagcaaactgctttctccggagtttaaacagttctttagccaa
tacagcattgctgtgggctcaaccggaaatctggggttatcaatcggcattatgagcgcc
cgcattggctttaaggtgacagttcatatgtctgctgatgcccgggcatggaaaaaagcg
aaactgcgcagccatggcgttacggtcgtggaatatgagcaagattatggtgttgccgtc
gaggaaggacgtaaagcagcgcagtctgacccgaactgtttctttattgatgacgaaaat
tcccgcacgttgttccttgggtattccgtcgctggccagcgtcttaaagcgcaatttgcc
cagcaaggccgtatcgtcgatgctgataaccctctgtttgtctatctgccgtgtggtgtt
ggcggtggtcctggtggcgtcgcattcgggcttaaactggcgtttggcgatcatgttcac
tgcttttttgccgaaccaacgcactccccttgtatgttgttaggcgtccatacaggatta
cacgatcagatttctgttcaggatattggtatcgacaaccttaccgcagcggatggcctt
gcagttggtcgcgcatcaggctttgtcgggcgggcaatggagcgtctgctggatggcttc
tatacccttagcgatcaaaccatgtatgacatgcttggctggctggctcaggaagaaggt
attcgtcttgaaccttcagcactggcgggtatggccggacctcagcgcgtgtgtgcatca
gtaagttaccaacagatgcacggtttcagcgcagaacaattgcgtaatgccactcatctg
gtgtgggcgacgggaggtggaatggtgccggaagaagagatgaatcaatatctggcaaaa
ggccgttaa

DBGET integrated database retrieval system