KEGG   Escherichia coli BL21(DE3): B21_02448Help
Entry
B21_02448         CDS       T02096                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ebe  Escherichia coli BL21(DE3)
Brite
KEGG Orthology (KO) [BR:ebe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ebe03009]
    B21_02448 (rluD)
Enzymes [BR:ebe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     B21_02448 (rluD)
Ribosome biogenesis [BR:ebe03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    B21_02448 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 TruB_N
Motif
Other DBs
NCBI-ProteinID: CAQ32965
UniProt: A0A140N6U7
Structure
PDB: 

Position
complement(2601540..2602520)
Genome map
AA seq 326 aa AA seqDB search
MAQRVQLTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRVLVNGKVCDKPKEKVL
GGEQVAINAEIEEEARFEPQDIPLDIVYEDEDIIIINKPRDLVVHPGAGNPDGTVLNALL
HYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQRREITREYEAVAIGHMT
AGGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHFRVHTRLRLRLETGRTHQIRVHM
AHITHPLVGDPVYGGRPRPPKGASEAFISTLRKFDRQALHATMLRLYHPISGIEMEWHAP
IPQDMVELIEVMRADFEEHKDEVDWL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgagtacagctcactgcaacggtgtccgaaaaccaactcggtcaacgctta
gatcaggctttggccgaaatgttcccggattattcacgttcgcgaataaaagaatggatc
ctcgaccagcgagtgctggttaacggcaaagtttgtgataagccgaaagaaaaagtattg
ggtggcgagcaggttgccatcaacgctgagattgaagaagaagcgcgttttgaaccgcag
gatatcccgctggatatcgtctatgaagatgaagacattattatcattaataaaccgcgc
gacctggtggtacatcctggcgcgggtaacccggatggcacggtactgaatgcgttgctt
cattactatccacccattgccgatgtaccgcgtgcgggcatcgtccatcgtctggataaa
gacaccactggcctgatggttgtggcaaaaaccgttccggctcagacgcgtttagtcgaa
tctttgcaacggcgtgaaattactcgtgagtatgaagcggtggcgattggtcatatgacc
gcaggtggcacggtggacgagccaatcagtcgccacccgaccaaacgtacccatatggcg
gtgcatccgatgggcaaaccagcggtgactcactatcgcatcatggaacacttccgtgtg
cacacgcgtctgcggttgcgtctggaaactggacgtacgcaccagatccgcgtgcatatg
gcccatatcactcatccgctggtgggcgatccggtttatggtggccgtccgcgtccgcca
aaaggtgcttcggaagcatttatctccacgctgcgtaagtttgaccgccaggcgctacat
gcaaccatgctgcgtctttatcacccgatctccggcatcgaaatggaatggcatgcgcct
attccacaagatatggtggagctgattgaggtgatgcgcgccgatttcgaagaacataag
gatgaagtggactggttatga

DBGET integrated database retrieval system