KEGG   Escherichia coli BL21(DE3): B21_03753Help
Entry
B21_03753         CDS       T02096                                 

Gene name
tpiA
Definition
(GenBank) triose phosphate isomerase monomer, subunit of triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00010  Glycolysis / Gluconeogenesis
ebe00051  Fructose and mannose metabolism
ebe00562  Inositol phosphate metabolism
ebe01100  Metabolic pathways
ebe01110  Biosynthesis of secondary metabolites
ebe01120  Microbial metabolism in diverse environments
ebe01130  Biosynthesis of antibiotics
ebe01200  Carbon metabolism
ebe01230  Biosynthesis of amino acids
Module
ebe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebe_M00002  Glycolysis, core module involving three-carbon compounds
ebe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B21_03753 (tpiA)
   00051 Fructose and mannose metabolism
    B21_03753 (tpiA)
   00562 Inositol phosphate metabolism
    B21_03753 (tpiA)
Enzymes [BR:ebe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B21_03753 (tpiA)
Exosome [BR:ebe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B21_03753 (tpiA)
  Exosomal proteins of bladder cancer cells
   B21_03753 (tpiA)
  Exosomal proteins of melanoma cells
   B21_03753 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAQ34270
UniProt: A0A140NEL5
Structure
PDB: 

Position
complement(4018656..4019423)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacccgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcattcgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system