KEGG   Escherichia coli BL21(DE3): B21_04213Help
Entry
B21_04213         CDS       T02096                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit, subunit of DNA polymerase III, preinitiation complex and DNA polymerase III, holoenzyme
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00230  Purine metabolism
ebe00240  Pyrimidine metabolism
ebe01100  Metabolic pathways
ebe03030  DNA replication
ebe03430  Mismatch repair
ebe03440  Homologous recombination
Module
ebe_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ebe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B21_04213 (holD)
   00240 Pyrimidine metabolism
    B21_04213 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    B21_04213 (holD)
   03430 Mismatch repair
    B21_04213 (holD)
   03440 Homologous recombination
    B21_04213 (holD)
Enzymes [BR:ebe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     B21_04213 (holD)
DNA replication proteins [BR:ebe03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     B21_04213 (holD)
DNA repair and recombination proteins [BR:ebe03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     B21_04213 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: CAQ34730
UniProt: A0A140NGI8
Structure
PDB: 

Position
4526172..4526585
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgaccaggtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcactgcaacagttggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgatttacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system