KEGG   Enterobacteriaceae bacterium FGI 57: D782_0858Help
Entry
D782_0858         CDS       T02431                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00071  Fatty acid degradation
ebf00280  Valine, leucine and isoleucine degradation
ebf00310  Lysine degradation
ebf00362  Benzoate degradation
ebf00380  Tryptophan metabolism
ebf00620  Pyruvate metabolism
ebf00630  Glyoxylate and dicarboxylate metabolism
ebf00640  Propanoate metabolism
ebf00650  Butanoate metabolism
ebf00900  Terpenoid backbone biosynthesis
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
ebf01212  Fatty acid metabolism
ebf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D782_0858
   00630 Glyoxylate and dicarboxylate metabolism
    D782_0858
   00640 Propanoate metabolism
    D782_0858
   00650 Butanoate metabolism
    D782_0858
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D782_0858
   00072 Synthesis and degradation of ketone bodies
    D782_0858
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D782_0858
   00310 Lysine degradation
    D782_0858
   00380 Tryptophan metabolism
    D782_0858
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D782_0858
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D782_0858
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D782_0858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebf04147]
    D782_0858
Enzymes [BR:ebf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D782_0858
Exosome [BR:ebf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D782_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGB76903
UniProt: L0LZ43
Position
870687..871880
Genome map
AA seq 397 aa AA seqDB search
MKDVVIVGAVRTPIGCFQGALSRHSAVELGSLVINALVERSGIEPHVIDEVIIGQVLTAG
TGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISREQQDAWAL
SSQHKARKAIDSGRFRDEIVPVVNAQPNGEALCVETDEQPQTDPSAEGLARLSPAFDQLG
SVTAGNASSINDGAAAVLMMSESKALELNLPILARIRAFASVGVDPALMGIAPVYATRRC
LERAGWQLNDVDLIEANEAFAAQAISVGKMLEWDEQKVNVNGGAIALGHPIGASGCRILV
SLVHEMMKRDARKGLATLCIGGGQGVALAVERDLPAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtcgttatcgtaggtgcagtccgtacacccatcggctgcttccagggggcg
ctctcccgccattcggctgtcgagctgggcagcctggtgatcaacgcgctggtcgaacgc
agcgggattgagcctcatgttattgatgaagtgattattggtcaggtgctgacggcgggc
accgggcaaaaccctgcccggcagtcggcgattaaaggcggcctgcccaataccgtttca
gccatcaccatcaatgacgtctgcggctcgggcctgaaagcgttgcatctggcgacgcag
gctattcagtgcggtgaagcggatgtggtgatcgcgggcggacaggagaacatgagccgc
gcgccacacgttctgaccgacagccgcaccggtgcgcagttgggtaacagtcagctgatt
gatagcctggtgcacgacggattgtgggacgcgtttaacgattatcatatgggcgtgacg
gcggagaatctggcacgcgaatacggcatcagccgtgaacaacaagatgcctgggcgctg
agttcccagcataaggcgcgcaaggcgattgattccggacgctttcgcgatgaaatcgtc
ccggtcgtaaacgcccaacctaacggtgaagcactgtgcgttgaaaccgatgaacagccg
caaaccgatcccagtgcggaaggcctggcgcggctttctcccgcattcgatcagctgggt
tccgtcaccgccgggaatgcgtcgtcgatcaacgatggcgccgcggcggtgttaatgatg
agcgaaagcaaagcgctggagctgaatttaccgatcctggcacgcatccgcgcgtttgcc
agcgtcggtgtcgatcccgcgctgatggggattgccccggtgtatgcgacccgccgttgt
ctggagcgagcgggctggcaactgaacgatgttgatcttatcgaagccaacgaagcgttt
gccgcgcaggcgatttctgtcggcaagatgctggagtgggatgagcagaaagtgaatgtg
aacggcggcgctatcgccctgggtcatcctattggcgcttccggctgccgtattctggtg
tctctggttcacgaaatgatgaaacgtgatgcccgcaaaggcctggcgacgctgtgcatt
ggcggcggtcagggcgtggcgctggccgtggaacgcgatttacccgccgcataa

DBGET integrated database retrieval system