KEGG   Enterobacteriaceae bacterium FGI 57: D782_1326Help
Entry
D782_1326         CDS       T02431                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase; short chain enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00071  Fatty acid degradation
ebf00280  Valine, leucine and isoleucine degradation
ebf00281  Geraniol degradation
ebf00310  Lysine degradation
ebf00362  Benzoate degradation
ebf00380  Tryptophan metabolism
ebf00410  beta-Alanine metabolism
ebf00640  Propanoate metabolism
ebf00650  Butanoate metabolism
ebf00903  Limonene and pinene degradation
ebf00930  Caprolactam degradation
ebf01040  Biosynthesis of unsaturated fatty acids
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
ebf01212  Fatty acid metabolism
Module
ebf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    D782_1326
   00650 Butanoate metabolism
    D782_1326
  Lipid metabolism
   00071 Fatty acid degradation
    D782_1326
   01040 Biosynthesis of unsaturated fatty acids
    D782_1326
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D782_1326
   00310 Lysine degradation
    D782_1326
   00380 Tryptophan metabolism
    D782_1326
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D782_1326
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D782_1326
   00281 Geraniol degradation
    D782_1326
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D782_1326
   00930 Caprolactam degradation
    D782_1326
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     D782_1326
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     D782_1326
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     D782_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGB77339
UniProt: L0M093
Position
1369802..1371952
Genome map
AA seq 716 aa AA seqDB search
MTTISAFSLTVRPDNVAIITIDVPDEKMNTLKAEFGTQVRAILKQIRDNKALQGVVIISA
KPDNFIAGADINMIGHCASAQEAEGLARQGQQIMAELNGLSIPVIAAIHGACLGGGLELA
LACHGRVCSDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMILTGKQLRARQAL
KVGLVDDVVPQTILLEAAVELAKQAPSRSRHLPVKERILAGPLGRNILFTLAGKKTEQKT
HGNYPATKKILEVIETGLAQGTSSGYDAEARAFGELVMTSQSKALRHIFFASTEIKKDPG
ASVEAGPLRAVGILGGGLMGGGIAFVTATKGKLPVRIKDINAKGINHALKYSWELLDNKV
RRRHIKANERDSQLALISGSTDYRGFAHRDLVIEAVFEDLALKQKMVSEVEQQCAPHTIF
ASNTSSLPIGDIAAQAQRPEQVIGLHFFSPVEKMPLVEVIPHAATSEQTIATTVKLAKKQ
GKMPIVVADRAGFYVNRILAPYINEAMRMLTDGERIEDIDNALVKFGFPVGPIQLLDEVG
IDTGTKIMPVLEAAYGDRFSAPATLISAILNDDRKGRKNGRGFYLYGAKGRTSKKQPDSA
IYSLPGMASRNSQLSPQQIAERCVLLMLNEAARCFDERVIRSARDGDIGAVFGIGFPPFL
GGPFRYMDSLGAGEVVARLQRLTTQYGPRFTPCEALVAMAERGETFWSPVETGLQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaatatccgcattttctctcaccgttcgcccggataacgtcgccataattacc
atcgatgtgccggacgaaaaaatgaataccctgaaggctgagtttggcacgcaggtgcgg
gcgatcctcaaacaaatacgcgacaacaaagcgctgcagggcgttgtgatcatctcagcc
aaacctgacaattttattgctggcgccgacatcaacatgattggccactgtgccagcgcg
caggaagccgaagggctggcgcggcaagggcagcagatcatggcggagctgaacggttta
tcgatcccggtgatcgccgccattcacggggcgtgtcttggcggcgggctggagctggcg
ttggcctgtcatgggcgcgtttgttctgacgaccccaaaacggtgcttgggttaccggaa
gtgcagcttggcctgctgccgggctcgggcggcacccagcgattgccgcgcctgattggc
gtgagtacggcgctggatatgatcctgacgggcaagcaactgcgcgcgcgacaggcgctg
aaggtcgggctggtggatgacgtggtgccgcagaccatcttgctggaagccgcggttgag
ctggcaaagcaagcgccatcacgctcacgccatctgccggtaaaagagcgcattctcgcg
ggccccctggggcgcaatattctctttacacttgccggaaagaaaactgagcagaaaacg
cacggcaactatccggcgaccaaaaagattctggaggtgattgaaaccgggctggcgcag
ggcaccagcagcggctatgacgcggaagcacgcgcgtttggcgagctggtgatgacttcc
cagtctaaagcgctgcggcatattttcttcgccagtacggagatcaaaaaagatccgggc
gccagcgtcgaggccgggccattgcgtgcggtggggatcttgggcggcggtctgatgggc
ggtgggatcgccttcgtgaccgccacgaaaggaaaacttccggtacgtatcaaagacatc
aatgctaagggtatcaaccatgcgctgaagtacagctgggagctgcttgataacaaggtg
cgtcgccgccatatcaaggctaatgagcgtgatagccaactggcgttaatttccggatcg
accgattatcgcgggtttgcgcatcgggatctggtcattgaagcggtgtttgaagatctg
gcgctgaaacagaaaatggtgagtgaagtcgagcagcagtgcgcgccgcacaccatcttt
gcgtcgaatacgtcgtcgctgccgattggcgatattgccgcccaggcgcaacggcctgaa
caggtcatcggcctgcactttttcagcccggttgaaaaaatgccgctggtggaggttatc
ccccacgcggcaacctctgagcagactatcgccaccacggtgaagcttgcgaagaaacag
ggaaaaatgccgattgtggtggccgatcgcgctgggttctatgtaaaccgtattttagcg
ccgtacattaacgaggcgatgcgcatgctgaccgacggcgaacgcatcgaagatattgat
aatgctctggttaaattcggttttcccgttgggcccatccagcttttggatgaggtggga
attgatacaggcaccaaaattatgccggtgctggaagcggcgtatggggatcgtttcagc
gcccctgcaacgcttatttcagcgattttgaacgacgatcgcaaaggcagaaaaaacggt
cgtggattctatctttatggtgcaaaagggcgtacaagcaagaaacagccggatagcgca
atttattcgctgccgggaatggcgtcgcgtaacagccagctttcgccgcagcagatagcc
gaacgctgcgtgttgctgatgctcaacgaagcagcgcgctgctttgatgaacgcgtgatc
cgcagcgcgcgcgatggcgacattggcgcggtgtttggcattggttttccaccgttctta
ggtggccctttccgttatatggattcactgggcgcgggtgaagtggttgccagattgcaa
cgactgacgacgcagtacggtccacgttttacgccatgcgaggcgttagtcgctatggca
gagcggggagaaactttttggtctcccgtggaaactggcttacaggcttga

DBGET integrated database retrieval system