KEGG   Enterobacteriaceae bacterium FGI 57: D782_1785Help
Entry
D782_1785         CDS       T02431                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00052  Galactose metabolism
ebf00561  Glycerolipid metabolism
ebf00600  Sphingolipid metabolism
ebf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    D782_1785
  Lipid metabolism
   00561 Glycerolipid metabolism
    D782_1785
   00600 Sphingolipid metabolism
    D782_1785
Enzymes [BR:ebf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     D782_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2 Spb1_C
Motif
Other DBs
NCBI-ProteinID: AGB77781
UniProt: L0M4X7
Position
complement(1854674..1856788)
Genome map
AA seq 704 aa AA seqDB search
MDPTHFLSGKTSALCIDTSNGGEILYWGRILGNSDAAKIALSRAVPYGRLDVDTPVSLMA
ENGRGLFGSPGIEGHRNGKHWSPVFTITQVEENEEGLQIHSEDRAAGLRVTTHLLFDSDT
DVIRIRHTLTNTDARAYDVSRLAVTLPLPERANECLSFYGRWVYEFQQHRHSLHHGGYQQ
ENRRGRTSHQHYPALICGTEGFGENHGELWGFHFAWSGNHRMRVDVKADGRRVLQAEALY
VPGEIVLQTQESVSTPWLYATWSGQGLNGMSQQFHRYVRRQLLSFTSAQPRQVHLNTWEG
IYFDHNPEYIMQMATQAAEMGVERFIIDDGWFTGRNDDKAALGDWFVDEDKYPQGLEPVI
AHVLNQGMTFGLWVEPEMISKNSALYRQHPDWLLQLSDYEQPTGRNQYVLDLCNEAVFTY
LYERLDDLLNRYDISYLKWDMNREVVQPGHQARPAQTRQVERLYDLMSMLHAKHPTVDIE
SCAAGGGRIDYEILRHVQRFWPSDNNDALERLSIQRGFSYFFPPEVMGAHIGAKKSHSTR
RVSDIHFRGITALFGHLGVELDPLQATEEDKKGFSRYINIYKQYRPLIHEGTLYRLDSDD
PQAQNITAIVSPNRRQALVVIAQRTMPTWALSGTLRIQGLEPQTAYKVSVIDAASNFKCG
IVSTQPAWVTEGVTLTGEWLQYAGLAMPVLDPESAVLLRVEALH
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggaccccacccactttctctcaggtaagacttctgctctatgtatcgataccagcaac
ggcggcgaaatcctttactgggggcggatactgggtaatagcgatgcggcaaaaatcgcc
ctttcccgcgcggtcccctatggtcggttagatgttgacacgccggtctcgctaatggcg
gaaaacggtcgcggtctgttcggcagcccgggcattgaaggccaccgcaacggcaaacac
tggtcgccagtgtttaccattacgcaggtggaggaaaatgaggaaggcttacagatccac
agtgaagatcgcgcggcaggcctacgcgtcactacgcatctgctgtttgactcagacacc
gacgttatccgcattcgccatacattaacgaatacagacgccagagcctacgacgtctcg
cgtctggctgtcaccctccccctacctgaacgggctaacgagtgcctctctttctatggt
cgatgggtgtatgaattccagcagcaccgtcactcactgcaccacggaggctatcagcag
gagaaccgccgggggcgaacttcacatcagcactatcccgccttaatttgtggcactgaa
ggcttcggcgaaaaccatggcgagctctggggctttcacttcgcctggagcggcaatcat
cgcatgcgtgttgatgttaaagccgatggtcggcgcgtgttacaagctgaagcgctatac
gtaccgggtgaaatcgtgctccagactcaggaatccgtctccacgccgtggctttacgcc
acctggagtggtcagggcctgaacggcatgagtcagcagttccaccgctacgtacgccgc
cagttactcagcttcacttcagcacagccacgccaggtacatcttaatacatgggaaggg
atctacttcgatcacaatccggaatacatcatgcagatggccactcaggccgccgagatg
ggagtcgagcgttttattattgatgatggctggtttactggtcgcaacgatgataaagcc
gcactgggagactggtttgttgatgaggacaagtacccgcaggggctcgaacccgtgatt
gcacacgtgctgaatcaaggtatgacgttcggcctgtgggttgaacctgaaatgatcagc
aaaaattcagccctctatcgccaacatccggactggctgctgcaattaagcgactacgag
cagccgaccggccgcaaccagtacgttctggatttgtgtaatgaagccgtcttcacctat
ctgtacgagcgtcttgacgatctgcttaaccgttatgatatttcgtacttgaaatgggat
atgaatcgtgaagttgttcagcccggtcatcaggctcgcccggcgcagacacgtcaggta
gaacgtctctacgacctgatgtccatgctgcatgcaaaacatcccacggttgatattgag
tcctgcgccgcaggtggcgggcgtatcgactacgaaatacttcgtcatgtacagcgcttc
tggccatcagacaataatgatgcgctggaacgcctctccatccagcgcggttttagctat
tttttcccaccggaagttatgggtgcgcatattggcgcgaaaaagagccactccacacgc
cgggtttccgatatccatttccgcggtattaccgccctctttggccatctcggcgtagaa
ctcgatccactgcaggccaccgaggaggataaaaaaggcttcagccgttacatcaacatc
tacaaacagtatcggccactgattcacgaaggcacgctgtaccgcctcgacagtgatgat
ccacaagcacaaaacatcactgccatcgtgtcccccaatcgccggcaggcgctggtagtc
attgctcagagaacaatgccgacatgggcacttagcggcacgctgcgcatccaggggttg
gaaccgcaaactgcctacaaggtgagcgttatcgatgccgccagcaacttcaagtgtggc
attgtcagcacccaaccagcatgggtgactgagggcgtcacattgacgggcgagtggctg
caatatgccgggctggcaatgcccgtattggacccggaatccgccgtactgctgcgggtt
gaagcacttcattaa

DBGET integrated database retrieval system