KEGG   Enterobacteriaceae bacterium FGI 57: D782_1916Help
Entry
D782_1916         CDS       T02431                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00040  Pentose and glucuronate interconversions
ebf00052  Galactose metabolism
ebf00500  Starch and sucrose metabolism
ebf00520  Amino sugar and nucleotide sugar metabolism
ebf01100  Metabolic pathways
ebf01130  Biosynthesis of antibiotics
Module
ebf_M00362  Nucleotide sugar biosynthesis, prokaryotes
ebf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D782_1916
   00052 Galactose metabolism
    D782_1916
   00500 Starch and sucrose metabolism
    D782_1916
   00520 Amino sugar and nucleotide sugar metabolism
    D782_1916
Enzymes [BR:ebf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     D782_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGB77905
UniProt: L0M571
Position
1997698..1998606
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVTKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEFESDLSQDNLAEMIKRFDETGSSQIMVEPVEDVTAYGV
VDCKGAPLAPGDSVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGVRHKTLGEEFTGWLKDTLGV
AK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctaaattcgaaagtgactaaggccgttatcccggtagcgggattaggtacc
aggatgttacctgctacgaaggcaattcctaaggaaatgctgccgctggtagataaacca
ttaattcagtatgtggtaaatgaatgtatcgccgcaggtatcactgaaattgtgctggtc
actcactcttccaagaattcgattgaaaaccattttgacaccagcttcgaactggaagct
atgctggaaaaacgcgttaagcgtcagctgctggaagaagtgcaatctatttgcccgccg
cacgtaaccattatgcaggtgcgtcagggcctggctaaaggtctgggacacgccgtatta
tgcgcgcatccagttgtgggtgatgagccagtcgcggttattctgccggacgttattctg
gatgaatttgaatccgatctgtctcaggataacctggcggaaatgatcaaacgctttgat
gaaacaggttcaagccagattatggttgagccggttgaagatgttaccgcttacggcgtg
gttgactgtaaaggtgctccattggcaccgggcgacagcgtaccgatggttggcgtggtt
gagaaaccaaaagctgatgtcgcaccgtctaacctggctatcgttgggcgttatgtcctg
agcgctgatatttggccgctgctggcaaaaacacctccgggagccggtgatgaaattcag
ctgaccgatgctatcgatatgctgatcgagaaagaaaccgttgaagcctatcatatgaaa
ggcaaaagccatgactgcggtaataaactgggttatatgcaggctttcgttgaatatggc
gttcgtcataagacactgggtgaagaattcactgggtggcttaaagacacgctgggcgta
gcgaagtaa

DBGET integrated database retrieval system