KEGG   Enterobacteriaceae bacterium FGI 57: D782_2182Help
Entry
D782_2182         CDS       T02431                                 

Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00020  Citrate cycle (TCA cycle)
ebf00620  Pyruvate metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
Module
ebf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D782_2182
   00620 Pyruvate metabolism
    D782_2182
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     D782_2182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo FAD_binding_3 K_oxygenase Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AGB78164
UniProt: L0M2K6
Position
complement(2274473..2276149)
Genome map
AA seq 558 aa AA seqDB search
MLCDITIMPAIKKTIISLTSVALFVSSATWANSETSQKTDFLLIGGGIMSASLGTWLQEL
QPDWKQVMVEKLDGVALESSNGWNNAGTGHSANMELNYTPERADGSIDVSKALDINEQFM
ISRQFWTAQVKRGILREPHSFINSTPHMSFVWGDTNVNYLQKRYDALQKTTLFQGMKFST
DHQQIQQWAPLVMQGRDPQQKVAATWTPAGTDVNYGEITRQLIGSLKKSPNFSLQTSSEV
TEFKRNGDNSWHVTIKDVNNGKEHAIDAKYVFIGAGGGALKLLQKTGIPEADNYAGFPVG
GSFLMTENPAITKEHLQKVYGQASVGAPPMSVPHIDARFIDGKRVVLFGPFATFSTKFLK
NGSFFDLLSTTTTSNVMPMTHVGLDNFDLVKYLISQVMLSDDDRFAALKEYYPQARKEDW
KLIQAGQRVQIIRKDEDKGGVLKLGTEVVVDQQRTISALLGASPGASTAAPITLNVIKKM
FPEQFSSEQWQSKIRAIVPSYGQELNGNSALTQQVWDDTAATLQLVKPPVIQMNTAESDN
VTPKAAQPEASPQHDMAL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgctatgtgatattactattatgcctgcaattaaaaagacaattatctcactcacctct
gtggcgctgtttgtcagttcggcaacctgggctaattctgaaacctcacaaaaaaccgat
ttcctgctgattggcggcggtattatgagtgcctctctgggtacgtggctccaggagttg
cagccagactggaagcaggtcatggtcgagaaactcgacggcgtggcgctggaatcttcc
aatggctggaataacgccggtaccggccactccgcgaatatggagctgaactatacgcct
gaacgtgcggatggttcgattgatgtcagcaaagcgctggatattaacgagcagtttatg
atctcccgtcaattctggacggcgcaggtgaaacgcggcattttacgtgaaccgcactcc
tttattaattccacgccgcatatgagttttgtctggggcgacaccaacgttaattatttg
caaaagcgctacgatgcgctgcaaaaaacgacgttgttccagggaatgaaattctctacc
gatcatcagcaaattcagcaatgggctccgctggttatgcaaggccgcgatccgcagcag
aaagtggccgcgacctggactccagccggtaccgatgtgaactacggtgaaattacccgt
cagctgatcggcagcctgaaaaaaagcccgaatttctctttgcaaacctcgtctgaagtg
acggagtttaaacgcaatggcgataactcttggcacgtgacaatcaaagatgtgaataac
ggtaaagagcacgcgattgatgcaaaatatgtgtttattggtgctggcggcggggcgctg
aaattactgcaaaaaaccggtattcctgaggccgataattatgctggcttcccggtaggt
ggttcgttcctgatgactgagaacccggctatcaccaaagagcatttgcagaaggtctac
ggccaggcgtccgtcggcgcgccgccgatgtccgtaccgcacattgatgcgcgtttcatc
gacggtaaacgcgtggtgctgtttgggccgttcgcgacgttctccaccaagttccttaag
aatggctcgttctttgacttgctaagcaccaccacaaccagcaacgtcatgccgatgacg
cacgtggggctggataacttcgacctcgtcaaatacctgattagccaggttatgctgagc
gatgacgaccgtttcgctgcgctgaaagagtactatccgcaggcgcgtaaagaagactgg
aaactgattcaggcggggcagcgcgtgcagatcatccgtaaagatgaagacaaaggcggc
gtgctgaagctgggtacggaagtggttgttgatcagcaacgcaccatttctgcgttgctg
ggcgcgtctccgggcgcctctaccgctgcgcctattaccctgaacgtgatcaagaaaatg
ttcccggaacagttcagttcagaacaatggcagagcaaaatccgtgcgatcgtgccaagc
tacggccaggagctgaacggtaacagcgcgttgacgcaacaggtctgggacgataccgct
gctacactgcagctggttaagccgccggtcattcaaatgaataccgccgaaagtgacaat
gtcacgcctaaggcagcacagccggaagcatctcctcagcacgatatggcgctgtaa

DBGET integrated database retrieval system