KEGG   Enterobacteriaceae bacterium FGI 57: D782_2190Help
Entry
D782_2190         CDS       T02431                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00250  Alanine, aspartate and glutamate metabolism
ebf00650  Butanoate metabolism
ebf00760  Nicotinate and nicotinamide metabolism
ebf01100  Metabolic pathways
ebf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D782_2190
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D782_2190
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    D782_2190
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     D782_2190
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     D782_2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGB78172
UniProt: L0M4E1
Position
complement(2281884..2283269)
Genome map
AA seq 461 aa AA seqDB search
MTSPATHAISINPANGETLSALPWATPAQVDESIVLADAGYRRWRNTPVAERAEALRAVG
RVLRQRGEEMAQMMSREMGKPIVQARGEVAKSASLCDWYAEHGPAMLNTESTLVEDNKAV
IEYRPLGPILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVMGSAELIGKIFNEAGL
PAGVFGWVNATNEGVTQAINDVRIAAVTVTGSVRAGRAIGAQAGAALKKCVLELGGSDPF
IVLDDADLDIAVQAAVIGRYQNTGQVCAAAKRFIVEAGIADAFTRRFVAATEKLKMGDPL
DEQNYLGPMARFDLRDELHQQVQATLAEGATLLLGGEKMAGTGNFYAPTVLGNVTSEMTA
FRQEMFGPVAAITVARDADHALELANDSEFGLSATVFTTDDVQAQRFAEQLECGGVFING
YSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKDRR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacctgcaactcacgcgatttccatcaacccggctaatggcgaaacactgtcg
gcattgccgtgggcgacacccgcacaggtcgatgagtctattgtccttgccgacgcgggc
tatcgtcggtggcgtaacacgcctgtcgctgaacgcgcggaggcattacgtgctgtaggg
cgcgtactgcgtcaacgtggcgaagagatggcacaaatgatgtcccgtgaaatgggcaaa
ccaattgttcaggcgcgcggggaagtggcgaaatcggccagtctttgcgactggtacgcc
gagcatggcccggcgatgctgaataccgaatccacgctggtggaggataacaaagccgtt
attgaatatcgcccacttgggccgattctggcaattatgccgtggaacttcccgctgtgg
caggtgctgcgcggtgcggtaccgattctgctggccgggaatagctatctgttaaaacac
gcgcccaacgttatgggcagtgccgaattgatcggcaagatcttcaatgaggcggggctt
ccagcgggcgtctttggctgggtgaatgctactaatgagggcgtgacgcaggcgattaac
gacgtgcgtatcgccgctgtgacggtgacgggaagcgtgcgtgcaggtcgtgctattggt
gctcaggctggtgccgcactaaaaaaatgcgttcttgagctgggcggttccgatcccttt
attgtgctggacgatgcggatctcgatatcgcggtgcaggcggccgttatcgggcgttat
cagaataccgggcaagtttgcgctgcggcgaaacgctttatcgttgaagcgggtatcgcg
gatgcctttacgcgccggtttgtcgcggcaaccgagaaactgaaaatgggcgatccactg
gacgagcaaaactatttaggtccaatggcgcgctttgatctgcgcgatgaactgcatcag
caggtgcaggctacgcttgccgaaggcgcgacgttgctgctggggggcgaaaaaatggcc
gggacgggcaatttctatgcgccgaccgtgctgggaaatgtcacgtcagagatgacggcg
tttcgtcaggagatgtttggtccggtggcggcaatcaccgtggcgcgcgatgccgaccat
gctcttgaactggcgaacgacagcgagttcggtctttcagcgaccgttttcactaccgat
gatgtgcaggcgcaacgctttgccgaacagctcgaatgtggcggggtatttatcaatggt
tatagcgccagcgatgcgcgcgtggctttcggcggcgtgaagaaaagcggatttggtcga
gaactgtcgcattttggtttgcatgaattctgcaacgtacaaacggtgtggaaggaccgt
cgataa

DBGET integrated database retrieval system