KEGG   Enterobacteriaceae bacterium FGI 57: D782_2327Help
Entry
D782_2327         CDS       T02431                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00071  Fatty acid degradation
ebf00280  Valine, leucine and isoleucine degradation
ebf00281  Geraniol degradation
ebf00310  Lysine degradation
ebf00360  Phenylalanine metabolism
ebf00362  Benzoate degradation
ebf00380  Tryptophan metabolism
ebf00410  beta-Alanine metabolism
ebf00627  Aminobenzoate degradation
ebf00640  Propanoate metabolism
ebf00650  Butanoate metabolism
ebf00903  Limonene and pinene degradation
ebf00930  Caprolactam degradation
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01212  Fatty acid metabolism
Module
ebf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    D782_2327
   00650 Butanoate metabolism
    D782_2327
  Lipid metabolism
   00071 Fatty acid degradation
    D782_2327
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D782_2327
   00310 Lysine degradation
    D782_2327
   00360 Phenylalanine metabolism
    D782_2327
   00380 Tryptophan metabolism
    D782_2327
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D782_2327
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D782_2327
   00281 Geraniol degradation
    D782_2327
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D782_2327
   00627 Aminobenzoate degradation
    D782_2327
   00930 Caprolactam degradation
    D782_2327
Enzymes [BR:ebf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     D782_2327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGB78305
UniProt: L0M6B9
Position
complement(2416985..2417752)
Genome map
AA seq 255 aa AA seqDB search
MSELIVARHERVLLLTLNRPQARNALNNALLEQIASELENAARDADISACVIFGNDRFFA
AGADLNEMAANDMPATLNDIRPRLWARIDAFNKPLIAAVNGYALGAGCELVLLCDTVVAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKALASRMVLTGEAIDVHQAQQAGLVSDVYPA
GLTLEYALKLAKTIARHSPLALQAAKQALRQSQEVGLHAGLQQERQLFTLLSATEDRQEG
INAFLQKRQPEFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgttgcacgccacgagcgcgtgctgctgttgacgctgaatcgcccg
caggcgcgcaatgccctcaacaatgccttgctggagcaaatcgccagcgaactggaaaac
gccgcgcgcgatgcggacatttctgcctgcgtcatcttcggcaatgaccgtttcttcgca
gccggcgcagatcttaacgagatggcggccaacgatatgcccgccacgctcaacgatatt
cgcccgcgtttatgggcgcgaatcgatgcgtttaataagccgctgattgccgccgtaaat
ggctatgcgctgggcgcaggctgcgaactcgtgttgctgtgcgacacagtggtcgcgggc
gataacgcccgtttcggcctgccggaaatcaccctcggcattatgccaggcgcgggcggc
acccagcgtttaattcgcagcgtcggtaaggcgcttgccagccgtatggtgctgacgggt
gaagcgattgacgttcatcaggcgcagcaggccgggctggtgagcgacgtctacccggcg
ggcttaaccctcgaatacgccctgaaactggcaaaaaccatcgcccgccattcaccgctg
gcattacaggcggcaaaacaggcgctgcgtcagtcgcaggaagtggggctgcatgcgggt
ctgcaacaggaacgccagctttttacgctgctgagtgcaaccgaagatcgtcaggaaggc
attaatgccttcctgcaaaaacgccaaccagaatttaaaggacgttaa

DBGET integrated database retrieval system