KEGG   Enterobacteriaceae bacterium FGI 57: D782_3134Help
Entry
D782_3134         CDS       T02431                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00020  Citrate cycle (TCA cycle)
ebf00190  Oxidative phosphorylation
ebf00650  Butanoate metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
Module
ebf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D782_3134
   00650 Butanoate metabolism
    D782_3134
  Energy metabolism
   00190 Oxidative phosphorylation
    D782_3134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS CbtB
Motif
Other DBs
NCBI-ProteinID: AGB79078
UniProt: L0M5A6
Position
complement(3219629..3219976)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGDLTWEVWSGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRMVLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctcagcattaggacgcaacggcgtacatgacttcatcctggtacgt
gccaccgccatcgtcctgactctgtacatcatctacatggttggctttttcgcgacgagc
ggcgacctcacctgggaagtctggagtggtttcttctcctctgcgttcaccaaagtgttc
accttgttggccctgttttctatcctgattcatgcctggattggcatgtggcaggtgctg
accgactacgttaaaccgctggcactgcgcatggtgctgcaactggcaatcgttgttgcg
ctggtggtttacgtcatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system