KEGG   Enterobacteriaceae bacterium FGI 57: D782_3633
Entry
D782_3633         CDS       T02431                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    D782_3633
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebf02044]
    D782_3633
Secretion system [BR:ebf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   D782_3633
SSDB
Motif
Pfam: T6SS_HCP DCAF15_WD40 SBBP
Other DBs
NCBI-ProteinID: AGB79552
UniProt: L0M8D0
Position
complement(3772410..3772928)
AA seq 172 aa
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPS
GQRAHKPFIFTVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTI
VDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacaccatgttacatttcaattacaggtcaaactcaggggaacatcaccgcaggt
gccttcacagcggattctgttggtaacatctacgtgcagggccatgaagatgaaatgctg
gttcaggagttcctgcataacgtcacggtccctaccgatcctcaatccggtcagccttcc
ggccagcgcgcccacaaaccgttcatctttacggtggcgctgaataaagccgtcccgctg
ctgtacaacgcgctggcttccggtgaaatgctgccgaaaaccgaactgcactggtggcgt
acttctgttgaaggcaaacaggagcattatttcaccacccgtctgaccgactcgacaatt
gtggatatgaaacttcatatgccgcactgccaggacccggcgaaacgcgagtttacccag
ttgctcgaagtttctctggcctaccgcaaaatcgagtgggaacacgtgaagtcaggtacc
tctggtgctgatgactggcgtgcgccgctggaagcctaa

DBGET integrated database retrieval system