KEGG   Enterobacteriaceae bacterium FGI 57: D782_3642
Entry
D782_3642         CDS       T02431                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    D782_3642
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebf02044]
    D782_3642
Secretion system [BR:ebf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   D782_3642
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AGB79561
UniProt: L0MA47
Position
3782086..3782904
AA seq 272 aa
MSEHSVLLPDGDDSQDTVAPPEWENAASHDSGERHSSRQYRLSLRGNSINAMIDAATPLL
GMVMRLSTMNSLMMPEHLFSQVVTDVQAVEQLLQEQGYEPGVIVSFRYILCTFIDEAALG
NGWSNRNEWIKQSLLVHFHNETWGGEKVFILLERLIREPKRYQDLLEFLYLCFSLGFRGR
YKVAVHNLDEFERIYRRLHHVLHTLRGDAPFPLLHQDKKTQGGRYQLIKRLTIKHVLLGG
IVVLALFYLFYMLRLDSQTQDILHQLNRLLAR
NT seq 819 nt   +upstreamnt  +downstreamnt
atgagcgagcactctgttttgctccccgatggggatgacagccaagataccgtcgcccca
ccggagtgggaaaatgcagcttcgcatgattcgggtgaacgacactccagccgccagtac
cgtctgtctctgcgtggcaacagcattaatgcgatgattgatgcagccacgccgctactc
ggcatggtaatgcgcctttcaaccatgaacagcctgatgatgccggagcacctgttcagc
caggtcgtcacggatgttcaggcggtggagcagttgcttcaggagcagggctatgaaccg
ggtgttatcgtatcgtttcgctacatcctctgcacttttattgatgaagcggcgctcggc
aacggctggtcaaaccgaaacgagtggatcaagcagtcgctgctggtccatttccacaat
gaaacctggggcggcgagaaagttttcattctgcttgaacgcctgatccgcgaaccaaag
cgttatcaggatttgctcgaatttctgtacctgtgcttttccctgggatttcgcgggcga
tataaagtcgcggtacacaatctggacgaatttgaacggatataccgccgcctgcaccac
gtcctgcacacactacgcggcgatgcgccttttcccttattacaccaggacaaaaaaacc
cagggcgggcgttatcagctcataaaacgcctgaccataaaacacgtcctgctgggaggc
atcgtggtgctggcgctgttttatctgttctacatgctgcgtctggacagccagacacag
gatattctgcatcaactgaaccggctactcgccaggtaa

DBGET integrated database retrieval system