KEGG   Enterobacteriaceae bacterium FGI 57: D782_3755Help
Entry
D782_3755         CDS       T02431                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00010  Glycolysis / Gluconeogenesis
ebf00020  Citrate cycle (TCA cycle)
ebf00620  Pyruvate metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01200  Carbon metabolism
Module
ebf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D782_3755
   00020 Citrate cycle (TCA cycle)
    D782_3755
   00620 Pyruvate metabolism
    D782_3755
Enzymes [BR:ebf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     D782_3755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: AGB79663
UniProt: L0M719
Position
complement(3905636..3907522)
Genome map
AA seq 628 aa AA seqDB search
MAIEINVPDIGSDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPAAAPAAAAAKDVHVPDIGGDEVEV
TEIMVKVGDTIAAEQSLITVEGDKASMEVPAPFAGVVKEIKINTGDKVSTGSLIMVFEVA
GEAGAAAPAKAEAAPAAAAPAASGSKDVNVPDIGGDEVEVTEVMVKVGDKIEAEQSLITV
EGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAAAPDQAAAAPA
PAAAPAPAAKAEGKSDFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQA
YVKDAVKRAESAPAAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVM
IPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLS
EDGQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTTISKKARDGKLTAGE
MQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFD
HRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaatgtaccggatatcgggtctgatgaagttgaaatcaccgagatc
ctggtcaaagttggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccgtctccgcaggctggcgtcgtcaaagagatcaaagtctct
gtcggcgacaaaaccgagactggcgcacttatcatgattttcgattccgccgacggtgca
gctgatgctgcacctgccaaggcagaagagaagaaagaagcggctccggcagcagcacct
gctgcggcagcggcgaaagacgttcacgtaccggacatcggcggcgacgaagttgaagtc
actgagatcatggtgaaagtgggcgataccatcgcggctgaacagtctctgatcaccgta
gaaggcgacaaagcctctatggaagttccggctccgttcgcgggtgtggttaaagagatc
aaaatcaacaccggcgacaaagtgtctaccggctcgctgatcatggtcttcgaagtggcg
ggtgaagcaggcgctgcggctccggcgaaagcggaagctgctccggcggcagctgctccg
gcagcatccggctcgaaagacgttaacgttccagatatcggcggcgacgaagttgaagtt
accgaagtgatggtgaaggttggcgataaaatcgaagccgaacagtctctgatcaccgta
gaaggcgacaaagcctctatggaagttccggctccgttcgcgggtaccgtaaaagaaatc
aaaatcagcaccggcgataaagtcaaaaccggctccctgattatggtcttcgaagtggaa
ggcgctgcgcctgctgcggctccggctgctgcaccggatcaggcggctgccgctccggca
cctgcggcagctccggctccggcggcgaaagccgaaggcaagtctgacttcgcagaaaat
gacgcttacgtccacgcaacgccggtgattcgtcgcctggcgcgcgaattcggcgtgaac
ctggcgaaagtgaaaggtacgggtcgtaaaggccgtatcctgcgcgaagacgttcaggct
tacgtgaaagacgcggtgaaacgcgcggaatctgcaccggcagctgcggctggcggcggt
attccgggcatgctgccatggccgaaagtggacttcagcaagttcggcgaagtcgaagaa
gtggaactgggtcgtatccagaaaatctctggtgctaacctgagccgtaactgggtgatg
atcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgtaaa
cagcagaacgccgaagctgagaagcgcaaactggatgtgaaattcaccccggttgtgttc
atcatgaaagcggttgccgcggctctggaacagatgcctcgcttcaacagctctctgtcc
gaagatggccagaaactgacgctgaagaaatacatcaacattggtgtggcggttgatacc
ccgaacggcctggtggttccggtctttaaagacgtgaacaagaagagcatcaccgagctg
tctcgcgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgacggctggcgaa
atgcagggcggttgcttcactatctccagcatcggcggcctgggtacgacccacttcgca
ccgattgttaacgcgccggaagtggctatcctcggtgtttccaaatcggcgatggagccg
gtatggaacgggaaagagtttgtaccgcgtctgatgatgcctatctctctctccttcgac
caccgcgtgatcgacggtgctgatggtgcacgctttatcaccatcatcaacaacacactg
tctgacattcgtcgcctggtgatgtaa

DBGET integrated database retrieval system