KEGG   Enterobacteriaceae bacterium FGI 57: D782_3818Help
Entry
D782_3818         CDS       T02431                                 

Definition
(GenBank) uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    D782_3818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AGB79725
UniProt: L0MAD2
Position
3983677..3984054
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVQVQSVYIESQSLPDEERYVFAYTVTIRNLGRTQVQLLGRYWLITNGHGRET
EVQGEGVVGVQPHIAPGDEYQYTSGAVLETPLGTMQGHYEMIDIDGRPFSIDIPVFRLFV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccgcgagtttgcgtccaggttcaaagtgtttacattgaatcgcagtct
ctaccggacgaagagcgttatgtcttcgcctacacggtaaccatccgcaatctcgggcga
actcaggttcagctactgggccgctactggctcatcaccaacggtcatggtcgtgaaacc
gaagtacagggcgagggcgtcgttggcgtccagccgcatatcgcacccggtgacgaatat
cagtacaccagcggtgcggtactcgaaaccccgcttggcaccatgcagggccactatgaa
atgatcgatatcgacggcaggccgttctctatcgacattcccgtattccgtctctttgtc
ccgacactaatccattaa

DBGET integrated database retrieval system