KEGG   Enterobacteriaceae bacterium FGI 57: D782_4248Help
Entry
D782_4248         CDS       T02431                                 

Definition
(GenBank) PTS system L-sorbose-specific IIB component, Man family (EC 4.A.6.1.3)
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00051  Fructose and mannose metabolism
ebf01100  Metabolic pathways
ebf02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    D782_4248
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    D782_4248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebf02000]
    D782_4248
Enzymes [BR:ebf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     D782_4248
Transporters [BR:ebf02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    D782_4248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AGB80135
UniProt: L0MBJ6
Position
4441906..4442400
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFNELNNLGVTLDLRVVASDPSINIIDKIKEQLVSN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgcctgatccacggccaggtcaccaccgtc
tggtcgaaagtggctaatgcccagcgcattattatctgcaatgacgaggtctataacgat
gaagttcgccggaccttattgcgccaggccgccccgccgggaatgaaggttaatgtcgtt
aatattgaaaaagccgtcgcggtttatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcacccgcccccaggatgccttagcgatggttcgccagggcgtaaaaatcggc
accctgaatattggcggcatggcctggcgccccggtaaaaaacagttaaccaaagccgtt
tcattagatgacgatgatattaacgcctttaatgagttgaataatcttggcgtcaccctg
gatttacgcgtcgtggcgtcagatccctcaataaatattattgacaaaataaaagaacag
ttagtctcaaattaa

DBGET integrated database retrieval system