KEGG   Enterobacteriaceae bacterium FGI 57: D782_4258Help
Entry
D782_4258         CDS       T02431                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00630  Glyoxylate and dicarboxylate metabolism
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01200  Carbon metabolism
Module
ebf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    D782_4258
Enzymes [BR:ebf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     D782_4258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGB80145
UniProt: L0MBK6
Position
complement(4455947..4457251)
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWASGIEPNDPRYTDYFLPIVADAEAGFGGVLNAYELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDAYDSEFITGERTSEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLDLARR
FAEAVHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLARSYAQGEGMKHYVEKVQQPEFEAGKDGYTFVSHQQEVGTGYFDNVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgctgg
gaaggcattcgtcgcccctacagcgccgaggaagtggtgaaattacgcggctcggttaac
ccggagtgcacgctggcgcaactgggtgcggcgaagatgtggcgactgctgcacggtgag
tcgaagaaaggctacgttaacagcctcggcgcgttgaccggcggccaggcgttgcagcag
gcgaaagcgggtattgaagctatctatctttccggctggcaggtcgcggctgacgccaac
ctggcatcaagcatgtatccggatcaatcgctttatccggcgaactcggtgccggcggtg
gtggatcggatcaacaacaccttccgtcgcgcggatcagatccagtgggcatccggtatc
gaaccaaacgatccgcgttataccgattatttcctgccgatcgttgccgatgcggaagcc
ggtttcggcggcgtgctgaatgcctatgaactgatgaaatcgatgattgaggccggtgca
gcggccgttcacttcgaagatcagctcgcgtcggtgaagaagtgcggtcatatgggcggg
aaagtgctggttccgacgcaggaagccattcagaaactggttgcagcgcgcctggcggcc
gatgtgatgggcgtgccgacgctggtgattgcacgtacggatgcggatgcggcggatctg
atcacctctgattgcgatgcttacgatagcgaattcatcaccggcgagcgcaccagtgaa
ggcttcttccgtacccgtgcgggtatcgagcaggcgattagccgtggcctggcatatgcg
ccgtatgcagacctggtgtggtgtgaaacctcaacgccggacctcgacctcgcgcgccgt
tttgccgaggcggtccacgctaaatatccgggcaagctgctggcctacaactgctcgccg
tcgttcaactggcagaaaaatctggacgataaaaccatcgcaagcttccagcaacaattg
tcggatatgggctacaaataccagttcatcaccctggcgggcattcacagcatgtggttc
aacatgttcgacctggcgcgctcttacgcgcagggtgaaggcatgaagcattatgttgaa
aaagtgcagcagcctgaatttgaagcgggcaaagacggttacaccttcgtttctcatcag
caggaagtggggacgggctacttcgataacgtgacgaccattattcagggcggtgcttcc
tcggtaaccgcgttgaccggctcaacggaagagtcacagttctga

DBGET integrated database retrieval system