KEGG   Enterobacteriaceae bacterium FGI 57: D782_4447Help
Entry
D782_4447         CDS       T02431                                 

Definition
(GenBank) lactaldehyde reductase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Pathway
ebf00010  Glycolysis / Gluconeogenesis
ebf00071  Fatty acid degradation
ebf00350  Tyrosine metabolism
ebf00625  Chloroalkane and chloroalkene degradation
ebf00626  Naphthalene degradation
ebf01100  Metabolic pathways
ebf01110  Biosynthesis of secondary metabolites
ebf01120  Microbial metabolism in diverse environments
ebf01130  Biosynthesis of antibiotics
ebf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ebf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D782_4447
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D782_4447
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    D782_4447
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D782_4447
   00626 Naphthalene degradation
    D782_4447
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     D782_4447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Glycolytic
Motif
Other DBs
NCBI-ProteinID: AGB80309
UniProt: L0M8R0
Position
4658307..4659455
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIADMVNLVANKQWGKALVVTDGQLVKLGLLDSLFAALDAQNMS
YHLFDEVFPNPTEALVQKGFAAYQDASCDFIIAFGGGSPIDTAKAIKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDTARQVKEVIIDSNIIPDIAVDDASVML
EIPASVTAATGMDALTHAIEAYVSVGAHPLTDVNALEAIRLITLWLPKAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
RVAQAMGVNTHGMSDEAASMEAINAIRQLSARVGIPEGFSKLGVTKADIEGWLDKALADP
CAPCNPRTASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcgcttcccaaaatcagcctgcacggcgcgggcgcgattgccgat
atggtcaaccttgtcgcaaacaaacagtggggcaaagcgctggtggtcaccgatgggcaa
ctggtgaagctgggtctgttggatagcctgtttgccgcgcttgatgcgcaaaatatgtct
taccatcttttcgatgaggtgttccctaaccctaccgaagcgctggtgcaaaaaggcttt
gcggcgtatcaggacgcgagctgcgatttcatcatcgcctttggcggcggcagcccgatc
gacaccgccaaagcgatcaaaattctgaccgccaaccctggcccgtctaccgcttattct
ggcgtgggcaaagtcaaaaatgcgggcgtgccgctggttgccattaacaccaccgcaggc
accgccgccgagatgaccagcaacgcggtgatcatcgacaccgcgcgccaggtgaaagag
gtcattatcgattccaatattattccggatatcgccgtggatgacgccagcgtgatgctg
gaaattccggcgtccgtcactgctgcaaccgggatggatgcgctgacccacgcgattgaa
gcttacgtctccgtcggcgcgcatccgctgactgacgtcaacgcgctggaagccattcgt
ctgatcaccctgtggctgccgaaagcggtcgatgatggccataacctggaagcccgcgag
cagatggcgtttggtcagtatctggcgggtatggcgttcaacagcgccggtcttggcctg
gtgcatgcactggcgcatcagccgggcgcaacgcacaatctgccgcacggcgtgtgcaat
gccatcctgctgccgatcatcgaaaactttaaccgcccgaatgcggtcgcgcgttttgca
cgcgtcgcgcaggctatgggcgtgaatacccatggaatgagcgacgaagcggccagcatg
gaagccatcaacgccattcgccaactgagcgcccgtgttggcattccggaaggtttcagc
aagctgggggtaacgaaagcagatatcgaaggctggctggataaagcgctggctgacccc
tgcgcgccgtgcaacccgcgcaccgccagccgcgatgaagtacgcgagctgtatctggag
gcgttatga

DBGET integrated database retrieval system