KEGG   Erwinia billingiae: EbC_02830Help
Entry
EbC_02830         CDS       T01270                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ebi  Erwinia billingiae
Pathway
ebi00630  Glyoxylate and dicarboxylate metabolism
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01200  Carbon metabolism
Module
ebi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EbC_02830 (aceA)
Enzymes [BR:ebi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     EbC_02830 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAX57814
UniProt: D8MLT0
Position
335709..337013
Genome map
AA seq 434 aa AA seqDB search
MTSRTQQIEHLTQSWNDARWEGITRPYTAEEVVRLRGSVNPACTLAQLGAEKLWHLLNGG
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAGSMYPDQSLYPANSVPSV
VERINNTFQRADQIQWANQIEPGDARHVDYYLPIVADAEAGFGGVLNAFELMKAMIQAGA
GGVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMAVPTVLIARTDADAADL
ITSDCDDYDREFITGERTPEGFFKTHAGIEQAISRGLAYAPYADVLWCETSTPDLSLAKR
FADAIHARFPGKLLAYNCSPSFNWKKNLDDNTIAHFQQSLSEMGYRFQFITLAGIHSMWF
NMFDLARSYAEGEGMRHYVEKVQQPEFAAREQGYTFSSHQQEVGTGYFDSVTNIIQGGVS
SVTALTGSTEEQQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcgtacccaacagatcgaacacctgacgcaatcctggaacgatgcacgctgg
gaaggcattacccgtccttacacagcggaagaggtggtgaggctgcgcggctcggttaat
ccggcctgcactctggcacagctgggagcagaaaaactgtggcatctgctgaacggtggg
tcgaagaagggctatatcaacagccttggcgcgctgaccggcggccaggcactgcagcag
gcgaaagcggggatcgaggcggtgtatctctccggctggcaggtggcggcggatgccaac
ctcgccggcagcatgtatcccgatcagtcgctctacccggccaactcggtgccatcggtg
gttgaacgcattaacaacaccttccagcgagccgatcagatccagtgggccaatcagatt
gaacctggcgacgcgcgtcatgtggattattacctgccgatcgttgccgatgcagaagcg
ggctttggcggcgtgctgaatgcctttgaactgatgaaggcgatgattcaggccggggca
ggcggggtgcattttgaggatcagctggcgtcggtgaaaaaatgcggccatatgggcggc
aaggtgctggtgcccacccaggaagcgattcagaagctggttgcggcaaggctggcggct
gatgtgatggcggtgccaacggtgctgattgcccgcactgacgcggatgccgccgactta
atcacctccgactgcgatgactatgaccgcgaatttatcaccggcgagcgcacgcctgaa
ggcttctttaaaacgcatgccggtattgagcaagcgatcagtcgcgggctggcttacgcg
ccctatgccgatgtgctgtggtgcgaaacctcgacgccggatttgtcgctggcgaagcgc
tttgccgacgctattcatgcccgtttcccgggcaagctgctggcctataactgctcgcct
tcgtttaactggaagaagaacctcgatgacaacaccatcgcgcatttccagcagtcgctg
agtgaaatgggttaccgcttccagtttattaccctggcgggcatccacagcatgtggttc
aacatgttcgatcttgcccgcagctacgccgaaggggaagggatgcgccattacgtggaa
aaagtgcagcagccggagtttgccgcgcgggagcagggttacaccttctcctcccatcag
caggaagtcggaaccggttattttgacagcgtcaccaatatcatccagggcggcgtctcg
tcagtgaccgcgctgaccggatcaacggaagaacagcagttctga

DBGET integrated database retrieval system