KEGG   Erwinia billingiae: EbC_03640Help
Entry
EbC_03640         CDS       T01270                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ebi  Erwinia billingiae
Pathway
ebi00010  Glycolysis / Gluconeogenesis
ebi00620  Pyruvate metabolism
ebi00640  Propanoate metabolism
ebi00680  Methane metabolism
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01130  Biosynthesis of antibiotics
ebi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_03640 (acs)
   00620 Pyruvate metabolism
    EbC_03640 (acs)
   00640 Propanoate metabolism
    EbC_03640 (acs)
  Energy metabolism
   00680 Methane metabolism
    EbC_03640 (acs)
Enzymes [BR:ebi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EbC_03640 (acs)
Lipid biosynthesis proteins [BR:ebi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EbC_03640 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAX57895
UniProt: D8MM11
Position
complement(430248..432203)
Genome map
AA seq 651 aa AA seqDB search
MSQQHRHPVPANIAENTLINAQQYESMYQQSVQDPDAFWGQEGKILDWIKPYTAVKNTSF
APGNITIRWFEDGTLNLAANCLDRHLHSRGDHPAIIWEGDDASESKTLTFRELHREVCRF
ANVLLELGVKRGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNA
RLVVTADEGVRAGRSIPLKKNVDDALANPGVTSIANVVVFRRTGKEVAWENGRDLWWHEL
VNKASAHHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPDDV
YWCTADVGWITGHSYLLYGPLACGATTLMFEGVPNWPKPSRMAEVVDKHKVTLLYTAPTA
IRALMAEGDKAIAGTDRSSLRIMGSVGEPINPEAWEWYYNKIGDGRCPIVDTWWQTETGG
FMITPLPGATELKAGSATKPFFGVQPALVDNEGNPQEGAGEGNLVIVDSWPGQARTLYGD
HDRFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIQHSIKGQAIYAYITLNSGEEPSAELYAEVRNWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIASGDTSNLGDTSTLADPGVVEKLLEEKQSIKMP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacaacaccgacatcctgttcccgccaatattgcggaaaacaccctgattaat
gcccagcagtatgagtccatgtaccagcagtccgtgcaggaccccgatgccttttggggc
caggaaggtaaaattctcgactggatcaaaccctataccgcggtgaagaacacctcgttc
gcgccgggcaatatcactatccgctggtttgaagacggcacgctgaacctggcggccaac
tgtctcgatcgccatctgcacagccgcggtgaccatccggcaattatctgggaaggcgat
gatgccagtgaaagcaaaaccctgaccttccgcgagttacaccgggaagtctgtcgcttt
gccaacgtgctgctggaactcggcgtgaagcgcggcgatgtggtggctatttatatgcca
atggtgcctgaagcggccgttgccatgctcgcctgcgcccgcattggcgcggtgcattcg
gttatttttggcggcttttcaccggaagccgttgccggccgtattatcgactccaacgcc
cggctggtggtcaccgccgatgaaggcgtgcgcgccggccgttcaatcccgctaaagaaa
aacgtcgacgatgcgctggccaatcctggggtgacatcgatcgccaacgtggtggtgttt
cgccgcaccggcaaagaggtggcctgggaaaatggtcgcgatctctggtggcacgagctg
gtcaacaaagccagcgcccaccatcagcccgaagagatgaacgcggaagatccgctgttt
atcctttatacctccggctccaccggcaagccgaaaggcgtgctgcacaccaccggtggc
tatctggtgtatgcggcgaccaccttcaaatatgtctttgattatcatccggatgacgtt
tactggtgtaccgctgacgttggctggatcaccgggcacagctatctgttgtatggcccg
ctagcctgtggcgccaccacgctgatgtttgaaggggtgccaaactggccgaaacccagc
cgcatggccgaagtggtcgataagcataaggtcaccctgctgtacaccgcgccgaccgcc
attcgcgccctgatggccgaaggcgacaaggcgattgcaggcaccgatcgcagcagcctg
cgcattatgggttcggtcggcgagccgattaacccggaagcctgggaatggtattacaac
aagattggcgacggccgttgcccgatcgtcgatacctggtggcagaccgaaaccggcggc
tttatgatcaccccgctgccgggtgccaccgagctgaaagccggttcggccaccaagccg
ttcttcggcgtgcagccggcactggtggacaacgaaggcaatccgcaggaaggcgcgggc
gaaggcaatctggtgattgtcgactcctggccgggccaggcgcgcacgctgtacggcgat
cacgatcgctttgaacagacctacttctccacctttaagaacatgtacttcagcggagac
ggtgcccgtcgcgatgaagatggctactactggatcaccggccgcgtggatgacgtgctg
aacgtctcaggccaccgcctgggcacggcagagattgagtcggcgctggtgtcgcatccg
aaaattgccgaagcggcagtggtcggtattcagcacagcattaaaggccaggcgatttat
gcctatatcaccctgaacagcggtgaagaaccgtcagcagagctgtatgccgaagtgcgt
aactgggtgcgtaaagagattggcccgattgccacgccggacgtcttgcactggacggat
tcactgccaaaaacccgctcggggaaaattatgcgccgtatcctgcgcaaaattgcctcc
ggcgataccagcaatcttggcgatacctcaaccctggccgatcctggcgtggtagaaaaa
ctacttgaagagaaacagtctattaagatgccttaa

DBGET integrated database retrieval system