KEGG   Erwinia billingiae: EbC_04120
Entry
EbC_04120         CDS       T01270                                 

Definition
(GenBank) Rhs element Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ebi  Erwinia billingiae
Pathway
ebi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EbC_04120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_04120
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_04120
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 PsbR
Other DBs
NCBI-ProteinID: CAX57943
UniProt: D8MM59
Position
490829..493330
AA seq 833 aa
MSINPVSFYSHSHHLLAVRNSTSQPDVLAFRGEERLSEPFRWRVEFTSADHAITREAMLM
KPASLTLQAPVDQGWGIRVQQPVRVVQGVVIGFERLSTSADQTHYTVTLQPRLALLSRSR
QNAIYQDLSVPQIVEKILRERHGMRGQDFVFTLSNEYPRREQVMQYGEDDLAFITRLLGE
VGIWFRFTTDTRLQIDVVEFYDGQQGHVKGLTLPAVPPSGMHDAAVDSVWDLASRFTVVE
KSVSGRDYNYRNASVDMNVQVDVTGGDDTTYGESYRWADNYLAPGDGYSHNPTPESGAFY
ARLRHERYLNGQTRVAAVTTCPALAPGCELKVSGEEEVSEVFRSGVLVTAIVSTARRDRS
FETAFDGIPLNNRYGFRPVSQPHPVMAGTLPARVTSTTVNDQYGHIDRDGRYRVNMLFDR
AGWETGFESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEHGNPDRPYIAGVLHDSAHGD
HVTIRNYKRNVLRTPKNNKLRLDDTAGQEHIKLSTEYGGKSQLNLGHLVDSEKQKRGEGF
ELRSDSWGSIRAEKGLLITADGQQRAQGQQLEMQAALSQLQQALSQAQALSSAVEEAKAE
LADIQSQKDLLAESLTELKKSALLLSAPAGIAQATPASLQLAAGENIISTSGKNTDFSVV
KNFTLAAGEAISLFANKMGMKLFASRGKVEIQAQSDEMTLDALKDIRISSSEGKLLISAK
QEIILTSGGGYIRIADGSIECGAPDNIVERATVWQKFAGQSFNVAAQQWSTSDFAVTPTV
LRLSDRSPVARQQLSLKNADGSQSALPTSASGAVDTQNSVSIDSLSATLPKKS
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgagcataaatccggtctctttttatagccacagccaccacctgctggcggtccgcaac
agcacgtctcaacccgacgtgctggccttcaggggtgaagaacgtctgagcgagccgttc
agatggcgcgtggagttcaccagcgccgatcacgccatcacgcgcgaggcaatgctaatg
aaaccggcctcgctgaccctgcaggctccggttgatcagggctggggcatcagggtgcag
cagccggtgcgcgtggtgcagggagtggtgatcggctttgagcgcctcagtaccagcgcc
gatcagacccactataccgtcaccctgcaaccgcggctggcgctactgtcgcgcagccgt
cagaacgccatctatcaggacctgtcggtgccgcagatagtcgagaaaatcctgcgtgag
cgccacgggatgcgcggtcaggactttgtcttcacgctgagcaacgagtacccgcgccgc
gagcaggtaatgcagtacggcgaggacgatctggcgtttatcacccgattgctgggtgag
gtaggcatctggttccgcttcaccaccgacacgcgcctgcagatcgacgtggttgagttc
tatgacggtcagcagggccatgttaaagggctgacgctgcctgccgttccaccttccggc
atgcacgatgcggctgtcgattcggtgtgggatcttgccagccgctttacggtggtggaa
aaaagcgtcagcgggcgcgattacaactaccgcaacgccagcgtagatatgaacgtgcag
gtcgatgtgactggcggtgacgacaccacctacggtgagtcctatcgctgggcggacaac
taccttgcgccgggcgatggttacagccataacccgactccggagagtggggctttctat
gcccgcctgcgtcacgagcgctacctgaacggccagacgcgggtggcggcagtcaccact
tgtccggcgctggcccctggctgcgagctgaaggtcagcggggaggaggaggtcagcgag
gtgttccgcagcggggtgctggtcaccgccatcgtcagcactgcgcggcgcgaccgcagc
tttgaaaccgcctttgacggtattccgctgaacaatcgctacggcttccgcccggtgtcg
cagccgcatcccgtgatggcgggtacgctcccggcgcgcgtcaccagtaccaccgtcaac
gatcaatacggccatatcgaccgcgacggtcgctaccgcgtcaacatgctgtttgaccgt
gcgggctgggaaacaggctttgaaagcctgtgggttcgtcaggcgcgtccctatgcgggc
gacacatatggcctgcacctgccgctgctggcgggtactgaagtggccatcgccttcgag
cacggcaacccggaccggccatatattgccggggtgctacacgactcggcgcatggcgac
cacgtcaccatccgcaattacaaacgcaatgtgctgcgcacgccgaagaacaacaaattg
cgcctcgacgacacggcgggccaggagcatatcaagctcagcaccgaatacggcggcaaa
agtcagctgaatctcggtcacctggtcgacagcgagaagcagaagcgcggcgaagggttt
gagctgcgcagcgacagctggggcagcatccgtgcagaaaaggggctactgataacggca
gatggccagcaaagggcgcagggccagcagctggagatgcaggcagcactgagccagtta
cagcaggcgctgtcgcaggcgcaggcgctaagcagtgcggtagaagaggccaaggccgaa
ctggcagatattcagtcacaaaaagacctgctggcagagagtctgaccgagctgaaaaag
tcggcattattactgagcgcgccggcgggtattgcccaggctaccccggccagcctgcag
cttgcggcgggtgaaaatattatcagcaccagcggcaaaaacaccgactttagcgtagtg
aaaaacttcaccctggcggcgggtgaagccatcagtctgtttgcaaacaagatggggatg
aaactctttgccagccggggaaaagtggaaatccaggctcagagtgatgagatgacgctg
gatgcccttaaggatatccgtatctccagcagcgaaggaaaactgcttatcagtgcgaag
caggaaattatcttaaccagcggtggcggatatattcgcatcgcggacggatcaatagag
tgtggtgcgccagacaacatcgttgagcgtgcgacggtgtggcaaaagtttgctgggcaa
agcttcaacgtggcggcccagcaatggagtaccagtgattttgcggtaacgccaacggtt
ttgcgcctttctgaccgctctcccgtggcgaggcagcagttaagtttgaaaaatgcagac
ggcagccagtctgccctgccaacctcggcatcgggggcggtggatacgcagaacagcgtc
agtattgattctctcagcgcgaccctgccaaaaaaaagctaa

DBGET integrated database retrieval system