KEGG   Erwinia billingiae: EbC_04230
Entry
EbC_04230         CDS       T01270                                 

Definition
(GenBank) ImpA domain protein
  KO
K11911  type VI secretion system protein VasL
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_04230
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_04230
SSDB
Motif
Pfam: VasL ImpA_N DUF4715
Other DBs
NCBI-ProteinID: CAX57954
UniProt: D8MM70
Position
507685..509085
AA seq 466 aa
MNDTPSRKIKTGNDPRTLADYAALRDELNKLSHPARPDVNWHYAEKLCLSLFEQNGVELQ
TAAWYTLARTQLAGLYGLNEGLSVLEALISHQWGALWPQPVHARMEILSGLSQRIQQLMR
TLPLSYSDISQLYRAEQHLTRLGDVLQRLELKHLSQLDALRSQMHNSAVRLENSDGAAGT
GAAIQPGVVLPAPATDGQASWANAPSGRPAADIYDRINAVKWVYVAQPEPQPNVAVLTTL
PAPAKSWKPFALGVITMLAAGSAALWGWHAFHRPDPLQAQLAASLAPLPAILSPAQRDSL
RQQASLPPQIAQTQRQLSSLAQLPPGWNIDYGRQLVEQAQILWPEQARPLVQAWQQQQKA
NALSAGSLSGWHQGMTKLTQLSERLSRLDEQKGKYMTVSELKSAVFATQQSFNQSIPAEE
QLRALSQTPTGQPLPAAAKAQLEMHLKQLTASYAEIKQNASRGERG
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaatgacaccccctcccgtaaaatcaaaaccggtaacgacccgcgtacgctggcggat
tatgccgccctgcgtgatgagctgaacaagctgtcccaccctgcgcggcccgatgtgaac
tggcactatgccgaaaagttgtgtctttcgctgtttgagcaaaatggcgtggagctacag
acggcggcctggtacacgctcgcccgcacgcagctggccggactgtatggccttaatgaa
ggattgtctgtcctggaggcattgataagccatcagtggggcgctctctggccgcagcct
gtgcacgcccgcatggagatcctcagcggtctgagccagcgtatccagcagctgatgcgc
accttaccgttgagctacagcgacatcagtcagctgtatcgtgccgagcagcacctcacc
cgtctgggggacgttctccagcggctggagcttaagcatctgagccagcttgatgcatta
cgtagccagatgcataacagcgctgtccggctggaaaacagcgatggcgccgctggcacg
ggcgctgcgattcaacccggcgttgtactgcccgcaccggcaacagacggccaggcaagc
tgggctaatgccccgtccggccgtccggcggcagatatttatgaccgcattaacgcggtt
aagtgggtgtatgtggcgcagccggaacctcagccgaatgtggccgtgttgacgacgctg
ccggcaccggcaaaatcctggaagccgtttgcgttgggggtgattaccatgctggcggca
ggaagcgccgcgctgtggggatggcatgctttccaccggcctgacccgctgcaggcgcag
ctggcggcatcgctggccccgctgcccgcgattctttctcccgcccagcgggatagcctg
cgccagcaagcgtcgttaccgccccaaattgcacaaacccagcggcagctttccagcctg
gcgcagttaccgccgggctggaatatcgattacggtcgtcagctggttgaacaggcgcag
atactgtggccggagcaggccaggccgctggtgcaggcgtggcagcaacagcagaaggcc
aatgcgttgtcagccgggagcctgtctggctggcatcagggtatgacgaagctgacgcaa
ctgagtgagcggctgagcaggctggatgaacagaagggaaaatacatgacggtcagcgaa
ctgaaatccgccgtgtttgccacccagcagtcatttaatcaatcgataccggctgaggag
cagctacgggcattgtcacaaacgcccacgggacagcctttgccagctgcagctaaagcg
cagctggagatgcatctgaagcagctaacggcgagctatgcagaaattaagcagaatgcg
tcaagaggggaaagaggctaa

DBGET integrated database retrieval system