KEGG   Erwinia billingiae: EbC_05520
Entry
EbC_05520         CDS       T01270                                 

Definition
(GenBank) Virulence factor for secretion apparatus
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ebi  Erwinia billingiae
Pathway
ebi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EbC_05520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_05520
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_05520
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAX58083
UniProt: D8MMM6
Position
complement(650001..650492)
AA seq 163 aa
MAIPAYLWLKDDGGADIKGSVDVRYREGSIEINAFTHRVYTPTDNNTGKITGNRIHGAFI
LEKEFDSSSTYLYKAVASGQTLKSAELKWYKINDAGQEAEYFNMLLENVKVVSVSPIMHD
CKDPAAQHQNHIENIELRYEKITWKHCDGNLIFSDSWNERKTA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattccagcttacttatggctgaaagacgatggtggcgcagacattaaaggctct
gtggacgtacgttacagggaaggaagtattgagataaatgcttttactcatcgtgtttat
acccctacggataataacacagggaaaatcactggaaatcgcatacatggcgcttttatc
ctcgaaaaagaatttgatagttcatctacctatctgtacaaagcggtagcttcaggccaa
acattaaaatctgctgaattgaagtggtacaaaatcaatgatgctgggcaagaagcagaa
tacttcaatatgctacttgaaaatgtgaaagtagtttcagtttccccgattatgcatgac
tgtaaagatccggccgcacaacatcaaaaccatattgaaaacattgaattaagatacgaa
aaaatcacatggaaacattgtgatggcaatttgattttttccgattcatggaatgaacgt
aaaacggcttag

DBGET integrated database retrieval system