KEGG   Erwinia billingiae: EbC_05820
Entry
EbC_05820         CDS       T01270                                 

Definition
(GenBank) conserved uncharacterized protein
  KO
K11902  type VI secretion system protein ImpA
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_05820
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_05820
SSDB
Motif
Pfam: ImpA_N DUF4197 DUF1403
Other DBs
NCBI-ProteinID: CAX58113
UniProt: D8MMQ6
Position
684258..685274
AA seq 338 aa
MNIDALLEPISADKPCGENLEYDADYMAMEQACAGKAEQQFGSTIIPAEPADWNKVERLA
SDLLSRTKDLRVMLALTRAWTQLKGLPGYANGLELIKQSLLRYWEPLWPVLEEDGERDPF
YRVNALAALSDKSALTTAARQAPLIRSASDEISLRDACALLDGSKTECPEYPGGLARLTD
ELARAGQPGVEAILSISERLQTIRQTLVEHLGETGVPEMEQLQKTVNTVAQACEVTDLAS
LIPGLTPASDEVPQPSPAARPARADMDWRTIQPGSRSDAQLMLEKVKQYFVQHEPSHPAP
LMIDRVQRMIALDFMDIIRDLAPDGVHQLENIFGRRDN
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaatatcgatgcgctacttgagccgataagcgctgacaagccctgcggcgagaatctg
gaatacgacgccgattacatggcgatggagcaggcctgcgcgggcaaagccgagcagcaa
tttggcagcaccatcattcctgccgagcctgcggactggaacaaagtcgagcggctggcc
agcgacctgctgagccgcaccaaagatctccgcgtgatgctggcattgacccgcgcctgg
acgcagctgaaagggctgccgggttacgccaacggcctggagctgatcaagcagtctttg
ctgcgttactgggagccgctctggccggtgctggaggaggacggtgagcgcgatccgttt
taccgcgtcaatgcgctggcggcgttaagcgataagtcagcactcactaccgcagcccgt
caggcccctttaattcgcagcgcctcagatgagatttcgctgcgcgatgcctgcgcactg
ctggacggcagcaaaaccgaatgcccggagtatcccggcggtctcgcacggctgacagat
gaactggcgcgtgcaggtcaacccggcgtggaagccatcctgagcataagtgagcggtta
caaacaattcgtcaaacgctggtggaacaccttggcgaaaccggcgtgccggagatggag
cagctgcaaaaaacggtgaacaccgtcgcgcaggcctgtgaagtcaccgatctggcgagc
ctgatccccggcttaacgccagcgagtgatgaagtcccgcagccatcgccagccgcaaga
ccggcgcgtgccgatatggactggcgcacgattcagcctggctcgcgttctgatgcccag
ctgatgctggaaaaagtgaagcagtactttgtgcagcacgagccaagccatccggctccg
ctgatgatcgaccgcgtacagcggatgatcgcgctcgactttatggacatcatccgtgat
ttggcgccagacggcgtgcatcagctggaaaatatcttcggacgccgcgataactga

DBGET integrated database retrieval system