KEGG   Erwinia billingiae: EbC_05830Help
Entry
EbC_05830         CDS       T01270                                 

Definition
(GenBank) conserved uncharacterized protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_05830
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_05830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: CAX58114
UniProt: D8MMQ7
Position
685322..685849
Genome map
AA seq 175 aa AA seqDB search
MATSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIELPFVMGVMSDLVGKSVEGLPAVDE
RKFLEIDIDNFDERMKALKPRVAFQADNTLTGEGRLNIDLTFNSMEDFSPDAVARNVEPL
NQLLDARTQLSNLLTYMDGKNGAEELISKILQDPTLLKSLSHLPKQDEAAKSGEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaagtaaatccagtgggcagaaatttatcgcccgtaaccgtgcgccacgtgtg
cagatcgaatacgacgtggagatctatggcgcggaacgcaaaattgaactgccgtttgtg
atgggcgtgatgtccgacctggtcggtaaatcggtcgaaggcctgccggccgtagacgag
cgcaagttccttgaaatcgatatcgacaacttcgacgaacgcatgaaggcgctgaaacct
cgcgtggcgttccaggcggacaacaccttgaccggcgaagggcgactgaacatcgatctg
accttcaacagcatggaagatttctcgccggatgcggtggcgcgtaacgttgagccgctg
aatcagctgctggatgcacgcacacagctttccaacctgctgacctatatggacggcaaa
aacggcgcggaagagctgatctccaaaattctgcaggatcctacgctgctgaaatcactg
agccacctgccgaagcaggatgaagccgctaaaagtggggaggaataa

DBGET integrated database retrieval system