KEGG   Erwinia billingiae: EbC_05840Help
Entry
EbC_05840         CDS       T01270                                 

Definition
(GenBank) conserved uncharacterized protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_05840
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_05840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB SH2_2
Motif
Other DBs
NCBI-ProteinID: CAX58115
UniProt: D8MMQ8
Position
685853..687352
Genome map
AA seq 499 aa AA seqDB search
MSNPSLQSELQEQQAYSQDEFSALLNKEFRPKTDSARAAVESAVKTLAQQALENTVTVST
DAYRTIQALIAEIDEKLSQQVNQIIHHEDFQKLEGAWRGLSYLVNNTETDEMLKIRFMSI
SKQELGRTLKRYKGVGWDQSPIFKKVYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLSE
MARIGAASHCPFITGTAPGVMQMESWQELANPRDLTKIFQNSEYAAWRSLRESEDARYLG
LVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHSNYTWTNAAYAMAANINRSFKEYGWCT
SIRGVESGGSVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSDF
AAFIGAQSLQKPAEYHDADATANARLASRLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLASAEVQVEEIEDNPGYYAAKFFLRPHYQLEG
LTVSLRLVSKLPSLKSNDA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatccttcactacagtccgaactgcaggaacagcaggcttacagtcaggatgag
ttcagcgcgctgctgaataaagagttccgtcctaagaccgactctgcgcgtgccgccgtg
gaaagcgcggtgaaaacgctggcgcagcaggcgctggaaaataccgtcaccgtttccacc
gatgcctaccgcacgattcaggcgctgatcgcggagatcgacgagaagctgtctcagcag
gtaaaccagatcatccaccacgaagacttccagaagctggaaggggcgtggcgtggcctg
agctacctggtgaacaacaccgaaaccgacgagatgctgaaaatccgctttatgagcatc
tccaagcaggaactgggccgcacgctgaagcgttataaaggcgtcggctgggaccagagc
ccgatcttcaagaaggtgtacgaagaagagtatggccagttcggtggcgagccgttcggt
tgcctggtcggcgattactacttcgaccacagcccgcaggacgttgagctgctgagcgaa
atggcgcgcattggcgcggcttcacactgtccgttcatcaccgggactgcgccgggcgtg
atgcagatggaatcctggcaggagctggcgaacccacgtgacctgaccaaaatcttccag
aacagcgaatatgccgcctggcgcagcctgcgggaatcggaagatgcccgttatctgggc
ctggtgatgccacgcttcctgtcgcgtctgccgtacggcattcgcaccaacccggtggac
agcttcgacttcgaagagcagaccgacggtgcgaaccacagcaattacacctggaccaac
gctgcctatgcgatggcggctaacatcaaccgctccttcaaagagtacggctggtgcacc
tcaatccgtggcgtggagtcaggcggttcggtagaaaacctgccttgccacaccttccca
agcgatgacggcggcgtggatatgaagtgcccgaccgaaatcgccatcagcgaccgtcgc
gaagcagagttggcgaaaaacggctttatgccgctggttcaccgcaagaactccgacttt
gccgcctttatcggcgcacagtctttgcagaagcctgcggaataccacgatgccgatgcc
accgcgaatgcccgtctggcatcgcgcctgccgtacctgttcgcctgctgccgcttcgcg
cattacctgaagtgcatcgtgcgtgacaagatcggatccttccgcgagcgtgacgagatg
gaacgctggctgaacgactgggtgatgaactacgtcgatggggatccggctaactcttcg
caggaaaccaaatcccgcaagccgctggcatctgcagaggtgcaggttgaagagatcgaa
gacaaccccggctactacgccgccaagttcttcctgcgcccgcactaccagctggaaggc
ctgaccgtgtcgctgcgtctggtatcaaaactgccttctttgaaatctaacgatgcgtaa

DBGET integrated database retrieval system