KEGG   Erwinia billingiae: EbC_05850Help
Entry
EbC_05850         CDS       T01270                                 

Definition
(GenBank) conserved uncharacterized protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ebi  Erwinia billingiae
Pathway
ebi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EbC_05850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_05850
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_05850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CAX58116
UniProt: D8MMQ9
Position
687947..688429
Genome map
AA seq 160 aa AA seqDB search
MAIDMFMKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVEA
LIDKSVTALLKNCASGKHLTKIELSICKAGGTQVEYARITLEDVLVTTVNYNGADNGDLV
GMSYSFQSSKVKQQYWEQSSSGGKGAESSAGWNIKENKEA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctattgatatgtttatgaaagttgacggtgtgactggcgaatcaaaagattcaaac
cacaccggttggaccgatattacttctttctcctggggcgcttcacagccaggcaatatg
tctgtgggcggcggcggcggtgccggtaaagtgaacttcaatgatttgcatgttgaggca
ttgatcgataagtcagtaactgctctattgaaaaattgcgcgagtggtaaacatcttact
aaaatcgaactttcgatctgtaaagcgggtggtactcaggttgagtatgcacgcattact
ctcgaagatgtcctggtaaccacagtaaattataatggtgctgacaatggcgacttagta
ggaatgtcgtattcattccagtcctctaaagttaaacaacagtattgggagcagagctcc
tcgggtggtaaaggcgcagaaagtagcgcaggttggaatattaaagaaaataaagaagcg
taa

DBGET integrated database retrieval system