KEGG   Erwinia billingiae: EbC_05880
Entry
EbC_05880         CDS       T01270                                 

Definition
(GenBank) Forkhead-associated (FHA) protein
  KO
K07169  FHA domain-containing protein
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    EbC_05880
SSDB
Motif
Pfam: FHA Translat_reg CDC27
Other DBs
NCBI-ProteinID: CAX58119
UniProt: D8MMR2
Position
692294..694342
AA seq 682 aa
MRFTIIATKSGQQPPQGSCDFMPPGGTIGRGTENNLVLPDENRSISRLQAIVHVSANGEC
QITNRGTVTLVHLNDIPLQRGRQVELQDGDIIRIDDYALQVSELGAGAQPIVSAPIARAV
VSDAPASAQASPQHVSSPSAAPNAASQPVPPNTAPQAAAAPSATAHAAQPPVSTQAASAN
TVIPQPQPSAPQPAAKENSPAAIPSEIWDSLAQEFSISDSLSNRSKPQPANLNPFAEAPA
PDRNPVDPLAQFASKPDSLNFDRRDQTPDSLFTDDDGLFKQDSIFNDSTPSTLMQQPAAQ
PQQPGKGKDELDPLALFGGSGGGAPAQANSDDPLGLMMGNAVPLTPMDASGSQPRPATQQ
PPQHTIVPPAPHALDSDFDLFAGDKSNTQHASPLFDDAPQHGDETPSRSADSPADLADSP
LFDQPPTAAQPDYGGITLPTPQAVARNTTPPPKGRLRIDPVSNTASQQSSSSASSGQVLD
GELLDALIGGMGLNDLQPTPRIDRDSMQELGQMLSMFSQGTVALLSSRSILKRGVKAEMT
VILDEANNPFKLLPSGKSVLMQMFGSRMPGFMPPKQSVRDALVDLQAHQLGMIAGIRAII
ASMLQSFNPQQLEEEAKQEGITSRISLPSSRKAALWEHFTKRYGETAGEIEDDFHTLFGE
AFLHAYDMEVNQYKDSQIRSEE
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgcgatttacgataatagcgaccaaatcgggtcagcaaccgccacagggtagctgcgac
tttatgccgccgggcggtaccattggccggggaactgaaaataatctggtgctgccggat
gagaaccgctccatctcccgcctgcaggcgattgtgcatgtcagcgcaaatggcgaatgc
caaattaccaaccgcggcaccgtcactctggtacacctgaatgatattcctctgcaacgc
ggccgccaggtggaactgcaggatggcgatatcatccgtattgatgattacgcactgcag
gtgagcgagctgggtgcgggcgcgcaacccatagttagcgcgccgattgcccgcgccgtg
gtaagcgatgcgccagcgtcagcgcaggcctcgccacagcacgtatcatcaccatcggcg
gctcccaatgccgcttcgcaacctgtaccgccgaacactgcaccgcaggcagcggctgca
ccgtctgcaactgcacatgccgcgcagccgccggtgtccacgcaggccgcctcagcgaat
acggtaattccacagccgcagccttcagcaccgcagcctgctgcaaaagagaactcgccc
gcagccatccccagcgaaatctgggacagcctggcgcaggagttttccatctccgacagc
ctgtctaatcgcagcaagccacagccggccaacctgaatccgtttgccgaggcaccggca
ccggatcgcaatccggtggatccgctggcgcagtttgccagcaagccggacagcctgaac
ttcgatcgccgcgatcaaacgccggattccctgtttaccgatgacgatggcctctttaag
caggacagcatcttcaatgacagcacgccaagcaccctgatgcagcagcctgcggctcag
cctcagcagccggggaaagggaaagatgagctggatccgctggccctgttcggtggcagc
ggcggtggtgcaccggctcaggccaacagcgacgatccgctgggcctgatgatgggcaat
gccgtaccgctaacgccgatggatgcgtcaggcagccagccgcgtccggcgacgcagcag
cctccgcagcacaccatcgtgccgccagcgccgcacgcgctggatagcgacttcgatctg
tttgccggtgacaaatccaatacgcagcacgcttcgccgctgtttgatgatgcgccacag
catggcgacgaaacgccgtcacggtcagctgactccccggcggaccttgctgactcgccg
ttgtttgatcagccgccgacggccgctcaaccggattacggcggcatcacgctgcccacg
ccgcaggcggtggcccgtaataccacgccgccgccaaaaggccgtctgcgcatcgatcct
gtttccaatacggcttcacagcagtcgtcgtcatcggcctccagtggccaggtgctggac
ggtgaactgctggacgcattaatcggcggcatggggctcaacgatctgcaaccgacgccg
cgcatcgatcgcgattccatgcaggaacttgggcagatgctcagcatgttctcgcagggg
accgtggcgctgctctcttcccgttcgatcctcaagcgcggcgtgaaggcagaaatgacg
gtgatcctcgacgaggcgaacaacccgttcaaactattgccgtcaggtaaatcggtgctg
atgcagatgttcggcagccgcatgccgggctttatgccgccgaaacagtcggtgcgcgat
gcgctggtcgatctgcaggcgcaccagttggggatgatcgccgggatccgcgcgatcatc
gcttcgatgttgcaatcctttaatcctcagcagctggaagaggaagcgaagcaggaaggg
atcacctcgcgcatctccttgccgagcagccgcaaagccgcgctgtgggaacacttcacc
aaacgctatggcgaaaccgccggtgaaatcgaagacgacttccataccctgtttggcgag
gcgtttctgcatgcctatgacatggaagtgaaccagtacaaagactctcaaatcagatcg
gaagaatga

DBGET integrated database retrieval system