KEGG   Erwinia billingiae: EbC_05930
Entry
EbC_05930         CDS       T01270                                 

Definition
(GenBank) Type VI secretion system, VCA0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_05930
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_05930
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAX58124
UniProt: D8MMR7
Position
697572..699449
AA seq 625 aa
MDSKLLDYYNRELAYLREMGAEFAERYPKVAGRLGMRGIDVADPYVERLMEGFAFLTSRV
QLKMDAEFPRFSQRMLEMIAPNYLAPTPSMAIAELHPDSQKGDISGGFRVPRGTMMDSQT
LKKSGVTCSYSTAHDVMLQPLTITSVELGGVPADIPLGPMGLSQRGAASALRIRLTCFND
VTLNTLTFDDLMFFLSGPDIQAQKLLELIMQHTVGSFCQTVEAQPQRVVMNDEALTQEGF
SPDQALLPDDLRNFDGYRLLQEYFAFPARFQFINISQLRGILGKCGPDVKAFEIVLLLDK
ADAALERVIDKSHLSLHCTPVINLFPKTAERQKISDSVHEYHLVVDNIRPLDYEIYSVQK
LYATGDKRRDEQVFRPFWSTFSQDHGDYGAYFSLRREQRTLSERAQRYGTRTGYVGSEVF
LSLVDERHSPWSDDLRHLTADVLCTSRDLPLMLLQQDQGNFLMPDSIPVGQLTLKKGPTP
PRPALAEGLTTWRLISHLQMNYLSLMDSDEGQGAAALRQLLGLYANLAEAPVARQIEGIR
HCQLKPVYRRVPEPGPIVFARGVGIELSVDEQAFSGSSPWLLGSVLERVFSRLVAMNSFT
EVTLISQQRGEVGYWSPRMGKRALI
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggacagtaaactgctcgattattacaaccgtgaactggcgtacctgcgcgaaatgggg
gcggagtttgccgaacgctacccaaaagtcgccggacggctggggatgcgcgggattgac
gtcgccgatccgtatgtcgagcggctgatggaaggctttgcctttctgacctcccgcgtg
cagttaaaaatggatgccgagttcccgcgtttctcccagcggatgctggagatgattgcg
ccaaactacctggcccctacgccgtcgatggcgattgcggagctgcatccggacagccag
aaaggcgacatcagcggcggctttcgcgtcccgcgcggcacgatgatggacagccagacg
ctgaagaaaagcggcgtcacctgcagctacagcaccgcccacgatgtgatgctacaaccg
ctgaccatcaccagcgtcgagctgggcggcgtgccggcggatatcccgctggggccgatg
ggcctcagccagcgcggagccgccagcgcgctacgcatccgcctgacctgtttcaacgac
gtaaccctgaacaccctgacctttgacgatctgatgttcttcctcagcggcccggatatt
caggcgcaaaagctgcttgagctgattatgcaacacacggtgggcagcttctgtcagacg
gtggaagcgcagccgcagcgggtggtgatgaacgatgaggcgctgacccaggaaggattt
tcgcctgaccaggccttgctgccggacgatctgcgcaacttcgacggctaccggctgttg
caggagtactttgcttttccggcccgtttccagttcatcaacatcagccagctgcgcggc
attctcggcaagtgcggcccggatgttaaagcgtttgagatcgtgctgctgctggataaa
gccgacgcggcgctggaaagggtgatcgataaaagccatctgtcgctgcactgcacgccg
gtgatcaacctgttcccgaagacggccgagcggcaaaaaatcagcgacagcgtgcatgaa
tatcatctggtggtcgacaatattcgcccgctggattacgagatttactcggttcaaaag
ctgtatgccaccggcgataagcgccgtgacgaacaggttttccgcccgttctggagcacc
ttcagccaggaccacggggattacggtgcctatttctcgcttcgccgcgaacagcgcacg
ctgtctgagcgcgcgcagcgttacggcacgcggaccggctatgtcggctcggaagttttc
ctgtcgctggtggatgaacgtcattccccgtggagcgatgatctgcgccatctgaccgcc
gacgtgctgtgcaccagccgcgatctgccgctgatgctgctgcaacaggatcagggcaac
ttcctgatgccggactcgattccggtcggtcagttaacgctgaagaaagggccaacgcca
ccgcgtccggcgctggccgaagggctgacgacctggcgcttgatcagccatctgcaaatg
aactacctcagcctgatggacagtgatgagggacagggcgctgccgcgctgcgtcagctg
ctggggctgtatgccaatctggcggaagcgccggtggcgaggcagatcgaaggcatccgc
cactgtcagttaaagccggtgtatcgccgggtgccggaacctggtccgatcgtcttcgcg
cggggcgtgggcatcgaactgagcgtggatgaacaggcgttctccggttcaagcccgtgg
ttactgggcagcgtgctggagcgggtcttttcgcggctggtggcgatgaacagctttacc
gaagtgacgctgatcagtcagcagcgcggtgaagtgggttactggtcgccaaggatgggc
aaaagggcgctgatatga

DBGET integrated database retrieval system