KEGG   Erwinia billingiae: EbC_05970
Entry
EbC_05970         CDS       T01270                                 

Definition
(GenBank) Rhs element Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ebi  Erwinia billingiae
Pathway
ebi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EbC_05970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_05970
Secretion system [BR:ebi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EbC_05970
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C HemeBinding_Shp
Other DBs
NCBI-ProteinID: CAX58128
UniProt: D8MMS1
Position
704738..706663
AA seq 641 aa
MLDRITVQLPMDGLLFWKLNGTEALSSAFEITVQLLSTDARIERKALLGQPITVSIPTQN
LMATRYLNGKITKVSVSSTELSGTRYAVYSLVMEPDLWPLKRDRNLRIFQSQTVTQIIKT
LLSEYNVTVEDKLTGNYRVWEYCVQYQESSFNFISRLMELEGIYYYFRHEADKHTMVLMD
SAQQHQPFSGYETIPYHVTPSGGSTSEEGISLWSLEDQVTPGLYSIDDYDFRKPNAWMFQ
ARQNPASPSPGQIDVYDWPGHFIDHDHGEFYARIRQEVWQAQHQQVTASGTALGLAPGNT
FTLLNAPFFSDNGEYLTIKAVYDFEENSYASSNSGSTIHKVDIVVIPSDVTFRPQPTAEW
PRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVNDEVVIDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFLSRSKDGSPDNA
NALRFEDKAGEEQVWIQAQKNMDTHVKADETQTVGGNQTISVEKALSSTVSGTYDQKTQW
TRSELVGSDYVLKVQGGMVLASGEGISLVSGDSMLTLMPNGTISLQCKQFQINASGQAEI
NTGGTLDLNINVPGTAAQPSPTPDEIKNDVMEAFQNKGSSK
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgcttgatcgcattacagttcaactgccgatggacggcctgctgttctggaaactgaac
ggcacggaggcgctttccagcgcgtttgaaatcaccgtccagctcctgagcaccgacgcc
cgcattgagcgtaaggccctgctggggcagcccatcactgtgtccatccccacccagaac
ctgatggcaacccgttacctgaacgggaaaatcactaaagtgtcggtcagcagcaccgag
ttgagcggcacgcgctatgcggtttacagcctggtgatggagccggacctgtggcccctg
aagcgcgacagaaacctgcgcatcttccagagccagacggtaacgcaaatcatcaaaacg
ctgctttccgaatacaacgtgacggtagaagacaagctcaccggcaactaccgcgtgtgg
gaatactgcgtgcagtatcaggaaagcagctttaacttcatcagccgcctgatggagctg
gaaggaatttactactacttccgccatgaggcggataaacacaccatggtgctgatggac
agcgcgcagcagcatcagccgttcagcggctacgaaaccattccgtaccacgtcaccccg
tccggcggctcgaccagcgaagagggcatcagcctgtggagcctggaagaccaggtgacg
ccggggctttacagcatcgatgactacgacttccgcaagcccaacgcgtggatgttccag
gcacggcagaatccggcctcaccgtcgccgggtcaaatcgacgtctacgactggccgggg
cattttatcgaccacgaccacggcgagttttacgccagaatccgccaggaagtgtggcag
gcccagcaccagcaggtcaccgcctccggcaccgcgctggggctggcgccgggaaacacc
ttcaccctgctgaacgcgccgttcttcagcgataacggcgaatacctgacgattaaggcc
gtttacgatttcgaagagaacagctacgccagcagcaacagcggcagcaccatccacaag
gtggatatcgtggtgatcccgtccgacgtcaccttccggccgcagccgacggcagaatgg
ccgcgcacccacggcccgcagacggcgaaggtggtggggccgaaaggcgaatcgatctgg
accgacaaatacggccgcatcaaggtgaagtttcactgggaccggctggcaaaaggcgac
gacaccagctcctgctgggtgcgcgtctccagcgcctgggcgggtcagggcttcggtggc
gtgcagatcccgcgcgtcaacgacgaggtggtgatcgactttatcaacggcgacccggac
cggccgatcgtcaccggccgggtctacaacgaagcgagcatgccgccgtgggcactgccg
gcagcggccacccagatgggcttcctcagccgctcgaaggacggttcgccggacaacgcc
aacgccctgcgctttgaagataaggccggggaagagcaggtgtggatccaggcgcagaag
aacatggatacccatgtgaaggcggatgaaacgcaaaccgtcggtggcaatcagaccatc
agcgtggaaaaagccctcagcagcaccgtgtccgggacttacgatcagaaaacacagtgg
acgcgcagtgagctggtcggcagtgattacgtgctgaaggtgcagggaggaatggtgctg
gcctccggggaaggtatcagtctggtatcgggcgacagcatgctcacgcttatgccgaac
ggcaccatatccttgcagtgcaaacagttccaaatcaatgccagcgggcaggctgaaatc
aataccggcgggacgctcgacctcaatattaatgtgccgggcacggcggctcagccctcg
ccaactccggatgaaatcaaaaatgacgttatggaagcatttcagaataaagggagcagc
aaatga

DBGET integrated database retrieval system