KEGG   Erwinia billingiae: EbC_07490Help
Entry
EbC_07490         CDS       T01270                                 

Gene name
aceF
Definition
(GenBank) Pyruvate dehydrogenase dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ebi  Erwinia billingiae
Pathway
ebi00010  Glycolysis / Gluconeogenesis
ebi00020  Citrate cycle (TCA cycle)
ebi00620  Pyruvate metabolism
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01130  Biosynthesis of antibiotics
ebi01200  Carbon metabolism
Module
ebi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_07490 (aceF)
   00020 Citrate cycle (TCA cycle)
    EbC_07490 (aceF)
   00620 Pyruvate metabolism
    EbC_07490 (aceF)
Enzymes [BR:ebi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EbC_07490 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: CAX58280
UniProt: D8MN73
Position
899236..901140
Genome map
AA seq 634 aa AA seqDB search
MAIEITVPDIGADEVEVTEIMVKVGDKVEVEQSLITVEGDKASMEVPSPQAGVVKEIKVA
TGDKIETGKLIMIFEDAEGAAAPAKAEEKKEEAKPAAAAAPAQAESKEVAVPDIGSDEVE
VTEIMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGVVKEIKISTGDKISTGSLIMVFET
AGSGSGSAPAEAKPEVKEEAAAAPAAASGAKEVAVPDIGDDEVEVTEIMVKVGDKVAAEQ
SLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSMIMVFEVEGAAPAAAAPAAAPQQ
AEPAKQEAKAAPAPAKAESKGEFAENDAYVHATPVIRRLAREFGVNLSKVKGTGRKGRIL
KEDVQSYVKDAVKRAESAPAAAAGGGMPGMLPWPKVDFSKFGEIEEVELGRIQKISGANL
SRNWIVIPHVTQHDKADITEVENFRKQQNDEAAKKKLDLKITPLVFIMKAVAKALEEFPR
FNSSLSEDGQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIVELSNELSVISKKARDG
KLTAGDMQGGCFTISSLGGIGGTSFTPIVNAPEVAILGVSKSSMEPVWNGKEFVPRLMLP
LSLSFDHRVIDGAAGARFAAYIATVMADIRRLVM
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaccgtaccggatatcggtgcagacgaagtggaagtcaccgagatt
atggtcaaggtgggcgacaaggttgaagttgagcagtcgctgatcaccgtagagggcgat
aaagcctctatggaagtcccttcccctcaggcgggcgtcgtgaaagagatcaaggttgct
accggtgacaaaattgaaaccggcaagctgatcatgatcttcgaagacgcggaaggtgct
gcggcaccggccaaagccgaagagaaaaaagaagaagcgaaaccggcggcagccgctgcg
cctgctcaggcagaaagcaaagaagtcgccgtgccggatatcggttctgacgaagttgaa
gtgaccgaaatcatggtcaaagtcggtgacacggtggaagccgagcagtcgctgattacc
gttgaaggcgacaaagcctcaatggaagtgcctgcacctttcgcgggtgtggtgaaagag
atcaaaatcagtaccggcgataaaatcagcaccggctcgctgatcatggtcttcgaaact
gccggttcaggttcaggttcggctccggctgaagcgaagccagaagtgaaagaagaagcg
gcagcggcacccgcagcagccagcggcgcgaaagaagtcgccgtgccggatatcggtgat
gacgaagtcgaagtcaccgaaatcatggttaaagtgggcgataaagtggctgccgagcag
tcgctgatcaccgttgaaggcgacaaagcctcgatggaagtcccggcaccgttcgcgggc
accgtgaaagagatcaaaatcagcaccggcgataaagtgaaaaccggttcgatgatcatg
gtcttcgaagtggaaggcgctgcgccagcggcggctgctccggcagcggcaccacagcag
gctgaaccggctaagcaggaagcgaaagcggctccggcaccggcgaaagcggaatccaaa
ggtgagttcgctgagaacgatgcttacgttcacgccacgccggttatccgtcgtctggca
cgtgagttcggcgtcaatctgtcgaaagtgaaaggcactggccgtaaaggccgcattctg
aaagaagacgtgcagtcttacgtcaaagatgcggttaaacgtgccgagtctgcacctgca
gcagcggccggtggcggtatgccgggcatgttgccatggccgaaagtggacttcagcaag
ttcggtgagattgaagaagtcgagctgggccgcatccagaaaatttcgggtgccaacctg
agccgtaactggatcgtgatccctcacgttacccagcacgacaaggccgacattaccgaa
gtggaaaacttccgtaagcagcaaaacgacgaagccgcgaagaagaaactggatctgaag
atcaccccactggtgttcatcatgaaggccgttgctaaagcgctggaagagttcccacgt
ttcaacagctcgctgtctgaagatggacagaagctgacgctgaagaaatacatcaacatc
ggtgtggcggttgatacgccaaacggtctggtggttccggtgttcaaagacgtcaacaag
aaaggcattgttgagctgtctaacgaactgtcggtaatttcgaagaaagcgcgtgacggt
aagctgacggccggcgatatgcagggcggctgcttcaccatctccagccttggcggcatc
ggtggcacgtcgttcacccctatcgtcaatgcgccggaagtggcgatcctcggcgtgtca
aaatcgtcgatggagccggtctggaacggtaaagaattcgttcctcgcctgatgttgcca
ctgtcgctttccttcgatcaccgtgtgatcgatggcgcagccggtgcacgcttcgcggct
tacatcgcaacagtcatggcggatatccgccgtctggtgatgtaa

DBGET integrated database retrieval system