KEGG   Erwinia billingiae: EbC_12130Help
Entry
EbC_12130         CDS       T01270                                 

Gene name
arnA
Definition
(GenBank) Bifunctional polymyxin resistance protein ArnA
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
ebi  Erwinia billingiae
Pathway
ebi00520  Amino sugar and nucleotide sugar metabolism
ebi01100  Metabolic pathways
ebi01503  Cationic antimicrobial peptide (CAMP) resistance
Module
ebi_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EbC_12130 (arnA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EbC_12130 (arnA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ebi01005]
    EbC_12130 (arnA)
Enzymes [BR:ebi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     EbC_12130 (arnA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     EbC_12130 (arnA)
Lipopolysaccharide biosynthesis proteins [BR:ebi01005]
 Unusual sugar
  EbC_12130 (arnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C NAD_binding_10 3Beta_HSD Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CAX58744
UniProt: D8MPI7
Position
1381538..1383526
Genome map
AA seq 662 aa AA seqDB search
MKAVVFAYHDMGCIGINALVNAGYEIEAIFTHADSSNENHFFASVARTAAEQGIPVYAPE
DVNHPLWVDRIRTMAPEVIFSFYYRNLLSDQLLSIATKGAFNLHGSLLPKYRGRAPLNWA
LVNGETETGVTLHRMVARADAGAIIAQDKVSISADDNALTLHRKLNAAAEHLLADCLPAL
RNGQISERAQDNTQVTVVGRRTPDDGRIDWSQPAEVVNNLVRAVTDPWPGAFGYVGAAKF
IIWKGKVRHDLPAAKAGTVLSVNPLVVACGEGALEVMTGQSENGVYMQGSQLAQTLGLVN
QALLTNKPVSAVKRRTRVLILGVNGFIGNHLTERLLQDDNFDIFGLDIGSDAISRFIGHP
RFQFVEGDISIHSEWIEYHIKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYKKRIIFPSTSEVYGMCDDPNFDEDTSNLVVGPINKQRWIYSVSKQLLDRVLWAYGDK
EGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLMDGGKQKRCFTDI
SDGVEALFRIIENKDNNCDGQIINIGNPDNEASIKELAEQLLASFERHPLRDRFPPFAGF
RDVESSSYYGKGYQDVEHRKPAIRNARRLLGWTPEVTMDKTIDATLDFFLRTVELDVPEE
KK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtcgtttttgcctatcacgatatgggttgcattgggatcaatgcgctggtg
aatgccggttatgaaattgaagcgatttttacccacgccgattcatctaacgagaaccac
ttttttgcctccgttgcccgtaccgccgcagagcaggggatcccggtgtatgcgcccgag
gatgtcaaccatccgctgtgggttgaccgcatcagaaccatggcgccggaggtcattttc
tctttctactaccgtaacctgctgagcgatcaattgttaagcatcgcgaccaaaggcgcg
tttaacctgcacggttctctgctgccaaaataccgtggccgcgcgccgctgaactgggcg
ctggtcaacggtgaaacggaaaccggcgtgacgctgcaccgtatggtggcccgtgccgat
gccggcgccattattgcgcaggataaagtcagcatttcggccgacgataatgcgctgaca
ctgcaccgcaaacttaatgccgccgctgaacatctgctggcggactgcctgccagcgctg
agaaatggtcagatcagcgaacgtgctcaggacaatacgcaggttaccgtggtgggacgc
cgtacgccggacgatggccgtatcgactggtcgcaaccggcggaagtggtcaacaacctg
gtgcgtgcggtgaccgatccgtggccgggtgcgtttggctacgttggcgcggccaaattc
attatctggaaaggcaaagtgcgtcacgatctgcctgccgccaaagccggaaccgtactg
tcagtgaatccgctggtggtggcctgtggtgaaggtgcgctggaagtgatgaccggacag
agcgaaaacggcgtttacatgcagggctcgcagctggcacaaactctgggtctggtaaac
caggcgctgttgaccaacaaaccggtttcggcagtgaaacgccgcacgcgcgtgctgatc
ctcggcgttaacggctttattggtaaccacctgaccgagcgcctgttgcaggacgataac
ttcgatattttcggcctggatattggctccgatgccatcagccgctttatcggccatccg
cgcttccagttcgtcgaaggggatatcagcatccattcggagtggattgaataccacatc
aaaaaatgcgacgtgatcctgccgctggtggccatcgccacgccgattgagtacacgcgt
aatccgttacgggtttttgagctcgatttcgaagagaacctgaagatcatccgcgactgc
gttaagtacaaaaaacgcattatcttcccgtccacctctgaagtgtacggcatgtgtgat
gacccgaacttcgatgaagacacctcgaatctggtggtggggccgatcaacaaacagcgc
tggatctactcggtttccaagcagctgttggatcgcgtgctgtgggcctatggcgacaaa
gaagggctgcgcttcaccctgttccgtccgtttaactggatgggcccgcgcctggataac
ctgaacgccgcgcgcattggcagttccagggcgatcacccaactgatcctcaatctggtg
gaaggatcgccgatcaaactgatggacggcggtaagcagaagcgctgcttcaccgatatc
agtgatggcgttgaggcgctgttccgcattattgaaaacaaagacaataactgcgacgga
cagatcatcaacattggtaacccggataacgaagcaagcatcaaagagctggcggaacag
ctgctggccagctttgagcgccatccactgcgcgatcgtttcccgccgtttgccggtttc
cgcgacgtggaaagcagcagctactacggcaaaggctatcaggacgttgagcaccgcaag
ccggcaatccgtaacgcccgtcgcctgctgggctggacgccggaagtgaccatggataaa
accatcgatgccacgctggacttcttcctgagaacggtcgaactggacgtgccggaagag
aaaaaatga

DBGET integrated database retrieval system