KEGG   Erwinia billingiae: EbC_13230Help
Entry
EbC_13230         CDS       T01270                                 

Gene name
galM
Definition
(GenBank) Galactose 1-epimerase (Mutarotase)
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ebi  Erwinia billingiae
Pathway
ebi00010  Glycolysis / Gluconeogenesis
ebi00052  Galactose metabolism
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01130  Biosynthesis of antibiotics
Module
ebi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_13230 (galM)
   00052 Galactose metabolism
    EbC_13230 (galM)
Enzymes [BR:ebi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EbC_13230 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAX58854
UniProt: D8MPU7
Position
complement(1501184..1502221)
Genome map
AA seq 345 aa AA seqDB search
MLTEPTSRAPDGQPWHITTLRNAGGMVATFMSWGATWLSARVPMKDGTVREALLGCATPA
DYLHQTAYLGATVGRYANRIAHSTFSGEGKTWQVAANQGPHQLHGGPEGFSSRRWQIVRQ
AEHEVEYQLDSPDGDQGYPGNLLVTLLYRLEDDNTLTIQYHATTDKACPVNLTNHAYFNL
DARHGDARDHKLQLNAERYLPVDSEGIPNADLKAVAGTSFDFRQPKTVAAEFLQDDDQRA
VKGYDHAFLLNTEDESQPAAELWSADGQLQLSVFTSAPALQFYSGNYLQGTPAREQGVYN
AFQGIALESEFLPDSPNHPEWPQPDCWLKPGESYQSITRYRLTAV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccgaacccacgtcccgtgcgccggatggtcagccgtggcatatcaccacgctg
cgcaatgcgggcggcatggttgccacctttatgagctggggcgccacctggctctccgcc
cgtgtgccaatgaaagatggcaccgtgcgtgaagccctgctcggctgcgccacaccggcg
gattatctgcatcagacggcttaccttggtgccaccgtcggtcgctatgccaaccgtatt
gcccattccacgttcagcggtgaaggcaaaacctggcaggttgcggccaatcagggacct
catcagctccacggcggcccggaagggttcagcagccgtcgctggcagatcgtccgccag
gcagagcatgaagtggaatatcagctggattcgcccgatggcgatcagggctatccaggc
aatctgctggtgaccctgctgtaccgtctggaagatgacaacacgctgaccatccagtat
cacgccaccacggataaagcctgcccggtgaacctgaccaatcatgcctacttcaatctg
gatgcccggcatggcgacgcccgcgatcataagttgcagttgaatgctgaacggtatctg
ccggttgacagtgaaggcatcccgaatgccgatctgaaagccgttgccggcaccagtttt
gacttccgccagccaaaaacggtcgccgccgagttcctgcaggatgacgatcagcgcgcg
gtgaaaggttacgaccacgccttcctgctgaacaccgaggatgaaagccagcccgcggcc
gaactctggtcggcagatggtcagctgcagctgagcgtatttacctcggccccggcgctg
caattttactcaggcaattatctgcaaggcacccctgctcgtgagcagggcgtctataat
gcctttcagggtatcgcactggagagcgagtttttacccgactcgccgaatcatcccgag
tggccgcagcctgactgctggcttaaaccgggtgaatcgtatcagtcgattacgcgctac
cgcctgacagcggtttga

DBGET integrated database retrieval system