KEGG   Erwinia billingiae: EbC_18890Help
Entry
EbC_18890         CDS       T01270                                 

Gene name
btuE
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ebi  Erwinia billingiae
Pathway
ebi00480  Glutathione metabolism
ebi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    EbC_18890 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    EbC_18890 (btuE)
Enzymes [BR:ebi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EbC_18890 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CAX59420
UniProt: D8MRG3
Position
2137729..2138274
Genome map
AA seq 181 aa AA seqDB search
MTIFDTKLETLDGEQTSLANWQGDVLLVVNVASKCGLTPQYEQLEALQKNWQEKGFSVLG
FPCNAFLGQEPGSAEEIKTFCSTTYGVTFPMFSKIEVNGPDRHPLYQQLVAAQPTASAPD
NSGFLERMSSKGRAPKEPGDILWNFEKFLIGRDGTVIQRFSPDMEPADPLIESAIKQALA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactattttcgacacaaaactggaaacgctggatggcgaacagacttctctggcgaac
tggcagggcgacgtactgttagtggtgaacgtggcatccaaatgcgggcttacccctcag
tacgagcagttagaagccttacagaaaaactggcaggagaaaggcttttcggtgctgggc
ttcccgtgcaatgcattcctcggtcaggaacctggcagcgcagaagagatcaaaaccttc
tgtagcaccacctatggcgtgaccttcccgatgtttagcaaaatcgaggtcaatggcccg
gatcgtcatccactgtatcaacagctggtggcggcgcagcctacggccagcgcacccgat
aacagtggtttcctcgagcgcatgtccagcaaaggccgtgcgccgaaagagcctggcgac
atcctgtggaatttcgagaagttcctgatcggtcgcgacggcacggtgatccagcgcttc
tcgccggatatggaacccgccgatccgctgattgagagtgcgattaaacaggctttggca
aaataa

DBGET integrated database retrieval system