KEGG   Erwinia billingiae: EbC_32510Help
Entry
EbC_32510         CDS       T01270                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ebi  Erwinia billingiae
Pathway
ebi00010  Glycolysis / Gluconeogenesis
ebi00052  Galactose metabolism
ebi00500  Starch and sucrose metabolism
ebi00520  Amino sugar and nucleotide sugar metabolism
ebi00521  Streptomycin biosynthesis
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01130  Biosynthesis of antibiotics
ebi01200  Carbon metabolism
Module
ebi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_32510 (glk)
   00052 Galactose metabolism
    EbC_32510 (glk)
   00500 Starch and sucrose metabolism
    EbC_32510 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EbC_32510 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EbC_32510 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EbC_32510 (glk)
Enzymes [BR:ebi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EbC_32510 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CAX60782
UniProt: D8MVC5
Position
complement(3606305..3607270)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCEVENGALSQAKTFSTADYDSLEAVIRFYLDEQKQEITDGC
IAIACPITDDWVEMTNHDWAFSTSKMKANLGFEHLEIINDFTAVSMAIPMLSADDVMQFG
GGKAVNDKPVAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAANSEEEDLILEVLRAE
LGHVSAERVLSGAGLVNLYRAIVKSDDRVPENLKPKDVSQRALDDSCTDCRRALAMFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKSSGFRAAFEDKGRFKDYVQNIPVFLIT
HDQPGLLGAGAHLRQTLGSVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtatgctttggtaggtgatgttggcggcacaaatgcccgcctggcactgtgt
gaagtagaaaacggtgccctttcacaagccaaaactttctccacagcagactacgacagc
cttgaagctgtgatccgcttctatcttgacgaacagaagcaggagattaccgacggctgt
atcgctattgcctgtccaatcactgacgactgggtcgagatgaccaaccatgactgggcg
ttctccaccagtaaaatgaaagccaacctcggctttgagcacctggagatcatcaacgac
tttaccgccgtttctatggccatcccgatgctgtccgcagacgatgtgatgcagttcggt
ggcggcaaagcggtcaacgacaagccggttgcggtctacggcgcagggaccggtctgggc
gttgctcacctggttcacgttgataagcgctgggtcagcctgccgggcgagggcggtcac
gtcgatttcgctgctaacagtgaagaagaagacctgatcctcgaagtgctgcgtgcggaa
ctgggccacgtctctgccgagcgcgtgctgtctggtgccggtctggtgaatctgtatcgg
gcgattgttaaatcagatgaccgggtgccggaaaacctgaagccgaaagacgtgtcgcaa
cgtgcgctggatgacagctgcaccgattgccgccgggcactggcgatgttctgcgtgatc
atgggccgctttggtggcaacctggcgctgaaccttggtacctttggcggtgtgtatatc
gccggcggtatcgtgcctcgcttcctggaattctttaaatcgtccggcttccgtgccgcg
tttgaagacaaaggccgctttaaggattacgtgcagaatattccggtattcctgatcact
cacgatcagccaggcctgctgggtgccggtgcgcacctgcgtcagacgctgggcagcgtg
ctgtaa

DBGET integrated database retrieval system