KEGG   Erwinia billingiae: EbC_35590Help
Entry
EbC_35590         CDS       T01270                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ebi03016]
    EbC_35590 (truC)
Enzymes [BR:ebi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     EbC_35590 (truC)
Transfer RNA biogenesis [BR:ebi03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    EbC_35590 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CAX61090
UniProt: D8MW83
Position
complement(3961542..3962321)
Genome map
AA seq 259 aa AA seqDB search
MLEILYQDQWLVAVNKPAGWLVHRSWLDRHETVFVMQTLRDQIGQHVFTVHRLDRPTSGV
LLLALSSEVARLLSQQFEQHAMQKTYHAVVRGWLEGEETLDYALTEELDKIADKFTNPDK
APQPAVTHWKSLAKAELPVAVSRYDSSRFSLVELKPETGRKHQLRRHLRHLRHPIIGDSA
HGDLKQNRSAAQHFGMKRLMLHASELSLLHPVTGEPLVLRAGLDSVWQGCMTAFCWQECL
PHIPRVEFVAANLQDSPSE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagatcctttatcaggaccagtggctggttgccgtcaataaaccggccggctgg
ttggtccaccgcagctggttagatcgccatgaaacggtgttcgtgatgcagaccctgcgc
gaccagattggtcagcatgttttcaccgtacaccggttggatcgcccgacgtccggcgtg
ctgctgctggcgttatcgagcgaggtagcgcgcctgctgtcgcaacagttcgaacagcat
gcgatgcagaaaacctaccatgcggtggtcagaggctggctggaaggggaagagaccctc
gactatgcgctgaccgaagagctggacaaaatcgctgataaattcactaacccggacaaa
gcgccacagcctgcggtaacccactggaaatcgctggccaaagcagagctgccggtcgcg
gtcagtcgttacgactcttcgcgcttcagtctggtcgaactcaagcctgaaaccgggcgc
aaacatcagctgcgccgtcatttacgccatcttcgccatccgattatcggcgacagcgcg
cacggcgatctgaaacaaaaccgtagcgcggcgcagcacttcggcatgaagcgtctgatg
ctgcatgccagcgagctgagtctgctgcatccggttaccggtgaaccgctggtactgcgt
gccggcctcgattcggtgtggcaagggtgcatgaccgccttttgttggcaggagtgcctt
ccgcatatcccaagggttgagtttgtggcggctaacctgcaggatagtccctcagaataa

DBGET integrated database retrieval system