KEGG   Erwinia billingiae: EbC_35650Help
Entry
EbC_35650         CDS       T01270                                 

Definition
(GenBank) Putative RNA 2\'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ebi03009]
    EbC_35650
Enzymes [BR:ebi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     EbC_35650
Ribosome biogenesis [BR:ebi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EbC_35650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 Spt5-NGN MIT_C
Motif
Other DBs
NCBI-ProteinID: CAX61096
UniProt: D8MW89
Position
complement(3967148..3968248)
Genome map
AA seq 366 aa AA seqDB search
MNKVLLYCRQGFEKECAAEITAKAAQREVFGFARVKDDSGYVLFECYQAEEAEKLIAELP
FSELIFARQMIVVGELLRDLPPEDRVTPVTGMLTGFVEKGGELRVEVPDTNESKELLKFC
RKFTVPLRSSLRAAGILLKYETDRRPVVHVFFIAPGCCYVGYSMPKNNSPLFMGIQRLKF
PSDAPSRSTLKLEEAFHAFIPADEWDERLGSGLFAVDLGACPGGWTYQLVKRSMMVHAVD
NGPMAPSLMDTGQVFHHREDGFKYRPTRSNIYWVVCDMVEKPVRVANLMADWVVNGWCRE
AIFNLKLPMKKRYEEVSQNLAMIDEKLKANGINAQIQARQLYHDREEVTVHIRRIWAAEP
GRRDEK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtattactgtattgccgtcagggctttgagaaagagtgtgcggcagaaatt
accgctaaagccgcccagcgtgaagtgtttggctttgcgcgggtaaaagacgattccggc
tacgtgctgtttgaatgctatcaggcggaagaagcggaaaagctgattgccgagctgcct
ttcagcgagctaatttttgcccgccagatgattgtggttggcgaactgctgcgcgacctg
ccgccggaagaccgcgtcacgccggtaaccggcatgctgaccggctttgtcgagaaaggc
ggcgaactgcgtgtcgaagtacccgacactaacgaaagtaaagagctgctcaagttttgc
cgtaagttcaccgtaccgctgcgcagcagcctgcgtgccgcgggcattttgttgaagtat
gagaccgaccgccgtcctgtggtgcacgtgttctttatcgcgccaggctgttgctacgtt
ggctactcaatgccgaaaaataactcgccgctgtttatgggcatccagcgcctgaagttt
ccttccgatgcaccaagccgttccacgctgaagctggaagaagccttccacgcctttatt
ccggccgatgaatgggatgagcgtttgggcagcggattgttcgcggtagatttaggcgcc
tgtccaggcggctggacctatcagctggtgaaacgcagcatgatggttcatgcggtagat
aatggcccgatggcgccaagcctgatggataccggtcaggtgtttcaccaccgtgaagac
ggcttcaaataccgcccaacccgcagcaatatctactgggtggtgtgcgacatggttgag
aagccggtgcgcgttgccaacctgatggctgactgggtggttaacggctggtgccgtgag
gcgatctttaacctcaagctgccgatgaaaaagcgttatgaggaagtgtcgcaaaacctg
gcgatgatcgacgagaagctgaaggccaacggcattaatgcccagatccaggcccgtcag
ctgtatcacgatcgtgaagaagtgacggtgcatatccgccgcatctgggctgcagagccc
ggacgccgtgacgagaagtaa

DBGET integrated database retrieval system