KEGG   Erwinia billingiae: EbC_36680Help
Entry
EbC_36680         CDS       T01270                                 

Gene name
rimK
Definition
(GenBank) Glutathione synthase/Ribosomal protein S6 modification enzyme(Glutaminyl transferase)
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
ebi  Erwinia billingiae
Pathway
ebi00270  Cysteine and methionine metabolism
ebi00480  Glutathione metabolism
ebi01100  Metabolic pathways
Module
ebi_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EbC_36680 (rimK)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EbC_36680 (rimK)
Enzymes [BR:ebi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     EbC_36680 (rimK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CAX61199
UniProt: D8MWJ2
Position
4087492..4088436
Genome map
AA seq 314 aa AA seqDB search
MIKLGIVMDPITSINIKKDSSFAMLLEAQRRGYEIHYMEMNDLYLRGGEARARTRTLSVE
QNYDKWFDFGSEQDIALADLNVVLMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR
DCNEKLFTAWFAELTPDTLVTRSAQKIREFWQEHGDIILKPLDGMGGASIFRIKKEDPNL
SVIIETLTEHGNFYCMAQNYIPAITEGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGG
RGEARPLTESDWEIARRVGPTLKAKGLIFVGLDIIGDKLTEINVTSPTCIREIEAAFPVS
ITGMLMDAIEKRLA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcttggcattgtgatggacccgattacctccatcaatattaaaaaagacagc
agcttcgccatgttgctggaagcacagcgccgtgggtacgaaattcattacatggaaatg
aacgatctctacctgcgtggcggcgaagcgcgtgcgcgcacccgcaccctgagcgtggag
cagaactacgacaagtggttcgacttcggcagcgagcaggacatcgcgctggccgatctg
aacgtggtattaatgcgcaaggatccaccgttcgataccgaattcatctacgccacctac
attcttgaacgtgcagaggaaaaaggcacgctgatcgtcaacaagccgcagagcctgcgc
gactgtaacgaaaagctgttcaccgcctggtttgccgagctgacgccggacacgctggtg
acgcgcagtgcccagaaaatccgcgagttctggcaggagcatggcgacatcattcttaag
ccgctggacggcatgggcggcgcgtcaattttccgcatcaagaaagaagacccgaatctg
tcagtgatcattgaaaccctgaccgagcacggcaacttctactgcatggcgcaaaactac
atcccggcgatcaccgaaggcgataagcgcgtgctggttgtggatggcgagccggtgcct
tactgcctggcgcgtattccaaagtccggcgaaacccgtggcaatctggcggccggtggc
cgtggcgaagcccgtccgctgaccgaaagcgactgggaaattgcccgtcgcgtcggccca
acgctgaaagccaaaggactgatttttgtcggtctggacattattggcgacaagctgacc
gaaattaacgtgaccagcccaacctgcatccgtgagatcgaggcagcattcccggtttca
attactggtatgctgatggacgcgattgaaaagcgtctggcctga

DBGET integrated database retrieval system