KEGG   Erwinia billingiae: EbC_42030Help
Entry
EbC_42030         CDS       T01270                                 

Definition
(GenBank) Transcriptional regulator, OmpR-family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ebi  Erwinia billingiae
Pathway
ebi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EbC_42030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ebi02022]
    EbC_42030
Two-component system [BR:ebi02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   EbC_42030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: CAX61734
UniProt: D8MY27
Position
complement(4659466..4660185)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactacaaaattctggtcgtggatgacgacatgcgtttacgtgcgttgctg
gaacgctatctgaccgaacagggtttccaggtgcgtagcgtggcgaacgctgagcagatg
gatcgtctgctgacgcgtgaatccttccacctgatggtgctggacctgatgctgcctggc
gaagatggcctgtctatctgccgccgtctgcgcagccagagcaacccaatgccgatcatt
atggtgacggcgaaaggcgaagaagtggatcgtatcgttggcctggaaatcggcgctgat
gactacattccaaaaccgtttaacccgcgtgagctgttggcccgtatccgtgccgttctg
cgtcgtcaggcgaatgaactgccgggcgcgccgtcgcaggaagaagcggtgatcgctttc
ggtaagttcaaactgaacctcggcacgcgtgaaatgttccgtgaagacgagcctatgcca
ctcaccagcggcgagttcgccgtgctgaaggcgctggtcagccacccgcgtgaaccgctg
tcccgcgataagctgatgaacctggcgcgtggccgtgaatacagtgcgatggaacgttcg
attgacgtgcagatctcccgcctgcgtcgcatggtggaagaagatccggcgcacccacgc
tatatccagaccgtttggggcctgggctacgtcttcgtgccggacggcagtaaggcatga

DBGET integrated database retrieval system