KEGG   Erwinia billingiae: EbC_pEb10200520
Entry
EbC_pEb10200520   CDS       T01270                                 
Name
(GenBank) conserved uncharacterized protein
Organism
ebi  Erwinia billingiae
SSDB
Motif
Pfam: TrbI Mod_r DUF1759 RNase_Y_N DUF4709 Leu_zip Sec10_N GAS DUF4407 GreA_GreB_N YabA XRCC4 TMPIT
Other DBs
NCBI-ProteinID: CAX53330
UniProt: D8MJE2
Position
pEB102:complement(46222..47727)
AA seq 501 aa
MLVPAILVGGGFIAVKSYNSKPQEPATQATHAQTDSALKNLSPQELKALGIEGDTPQDTL
KTIVGSLNAVRQQQDSLNKQNTRLLDENEKLRERNTNVSGQVNEAVQGVEKSYHARENQM
RQQQNVLTSKINELTNKLQNAGKSVADKTKGQDGDIPLGLGLDGMSGGGGNSPTSGSDGL
MWVTPQDSPSTSPSQNNSASASSAGEAKFPTSFLSENALTKQKGSYEQQVKGSTSEKGEE
EEAEPVYTLPENSTLIGSRAMTALLGRVPINGTVTDPYPFKVLIGKDNLTANGIELPDVE
GAIVSGTASGDWTLSCVRGQVNSVTFVFTDGTVRTLPKPDRSGKGGNSGNQNGGKETGTS
GGIGWISDENGIPCISGTRKSNASSYLPTIGLLGAAGAAGDAIGQNQQTSQTNAYGGVTS
TLTGDAGQAVLGKAISGSSDEITEWVKQRYGQTFDAIYVQPGAKLAVHITRELAIDYEDK
GRRIRYDFTMPGEDGSTGGLD
NT seq 1506 nt   +upstreamnt  +downstreamnt
gtgctggttcctgccattctggttggcggcggattcattgcggtgaaaagctataacagc
aaaccgcaggagcccgccacgcaggctacacacgcgcagacagacagtgcactgaaaaat
ctgtcaccgcaggagctcaaggccctcggcattgagggcgacacaccgcaggatacgctg
aaaacgatagtgggctcgcttaacgctgtccgtcagcagcaggactctctgaataagcaa
aataccagactgctggacgaaaatgaaaagctacgcgagcgcaacaccaacgtttcaggg
caggtcaatgaagcagttcagggcgtggagaaaagctatcacgcgcgtgagaatcagatg
cgtcagcagcagaacgtcctgacctcaaaaatcaacgagctgacgaataaactgcagaat
gccggtaagagtgttgccgacaagacgaaaggccaggatggcgatattcctctggggctg
ggcctcgacggtatgagtggcggcggcggaaattctccgacttccggcagtgatggcctg
atgtgggtcacaccgcaagacagtccgtccacttctccatcacagaacaatagcgcgtcg
gccagcagcgccggtgaagctaaattcccgacgtcgtttctcagcgaaaacgccctgaca
aagcaaaaaggcagctatgagcagcaggttaaaggatctacgtctgaaaaaggtgaagaa
gaggaagccgaaccggtttatacgctgcctgagaactccacgctgataggcagccgcgcg
atgacggcgctgctcggccgcgtgccgatcaatggcacggttaccgatccgtatcccttt
aaagtactcattggcaaagacaacctgacggccaacggcatcgagctgcccgacgttgaa
ggggctattgtttccggcaccgcttccggcgactggaccctgtcctgcgtgcgtggtcag
gtcaatagtgtcacgtttgttttcaccgatggcaccgtgcgcacgctgccgaaaccggac
cgcagcggcaaaggcggtaatagcggcaaccagaatggaggaaaagagaccggcaccagt
ggtggcatcggctggatttccgatgaaaacgggatcccatgtatctccggtacgcgcaaa
tcaaacgcttcaagctatctgccaacgattggtttgctgggcgcagcgggcgcagcggga
gatgcaatcggtcagaatcagcagaccagccagaccaacgcctacggcggcgttacctca
actctgaccggcgacgccggacaggccgttttaggtaaggctatttcgggcagctcagat
gaaatcaccgagtgggtcaaacagcgttacgggcagacttttgatgctatttacgtgcag
cccggggcaaaactcgccgtacacattacccgcgaactggcgatcgattacgaagataaa
gggcggcgcatccgttatgacttcaccatgcctggtgaagacggcagcaccggcggactg
gactga

DBGET integrated database retrieval system