KEGG   Erwinia billingiae: EbC_pEb10200530Help
Entry
EbC_pEb10200530   CDS       T01270                                 

Definition
(GenBank) conserved uncharacterized protein
Organism
ebi  Erwinia billingiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: CAX53331
UniProt: D8MJE3
Position
pEB102:complement(47747..48664)
Genome map
AA seq 305 aa AA seqDB search
MNPSYTSGSRACLIALSLSLLPAIVMHSSQAHADELMKWERVPLQIPLKTGQERVIFVDK
NVRVGFPPALNGKLRVQSTGGAVYLKADGDFPQTRLQLQDMESGEVILLDVRTTATASAE
PVKIVYSGDVSTLNSATEGEGQKSNADAGSQQTKRKKVSYKAPIPVLLTRYAAQNLYAPE
RTVEAVPGIHPVNPHLPSRITTLYPSAPVTVSPVAGWGVAGRTVVALRIRNSSSQKVVLD
PRELQGQFVTATFQHRWLGAAGTPEDTTTLYLVTSGRPDEAFVREPSIVRKATSRTAQKV
IRYEN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacccatcatatacctcaggctcccgcgcatgcctgattgctttatcactgtccctg
ctgccggccatcgtgatgcattcctctcaggcacatgcggatgaactgatgaaatgggaa
cgcgttccgctgcagatcccgcttaaaacgggtcaggaacgggtaatcttcgttgataag
aacgtgcgcgtgggttttccaccggcgctgaatggcaagcttcgcgtgcagagtaccggc
ggtgcggtgtatctcaaggctgacggcgatttcccgcagacccgcctgcaactgcaggac
atggaaagtggtgaagtaatcctgctggacgttcgtacaactgcaactgcatcagctgaa
ccggtcaaaatcgtttacagcggagacgtcagcacgctcaacagcgcgaccgaaggtgaa
ggccagaaatccaatgctgatgccggcagtcagcagacgaagcgtaaaaaagtcagttat
aaagctcccattccggtgctactgacccgttatgcagcccagaatctgtatgcaccggag
cgtaccgttgaagccgtgccgggtattcacccggtgaatccacatcttccgtcacgtatc
acaacattatatccgtcggctcccgtgacggtgtcacccgtagccggttggggtgtggcc
ggacgcaccgttgtagcgctcaggatccgaaacagctcgtcacagaaagtggttctcgac
ccgcgcgaactgcagggccagtttgtgacggccacctttcagcatcgctggctgggtgcc
gccggcacgccggaagataccaccacgctttacctggtcacgtctggccgccccgatgaa
gcatttgtgcgcgagccctcgattgtccgtaaagccacttcccgcactgcccagaaggtg
atccgctatgaaaattaa

DBGET integrated database retrieval system