KEGG   Erwinia billingiae: EbC_pEb17202060Help
Entry
EbC_pEb17202060   CDS       T01270                                 

Gene name
traF
Definition
(GenBank) conjugal pilus assembly protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_pEb17202060 (traF)
Secretion system [BR:ebi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   EbC_pEb17202060 (traF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraF
Motif
Other DBs
NCBI-ProteinID: CAX53659
UniProt: D8MK61
Position
pEB170:150567..151364
Genome map
AA seq 265 aa AA seqDB search
MMRALLLAAVMACALPAFADGPPPADEVVDPADPFTGWHWYNEPKKKAETPAPKPRPTQQ
VPDFSRLSPGEQADVLKGYTKEALNNAILHPSAENTATFLRWQKFWTDRASMFSQSFAVA
QLHHPDLDYNLEHPHYNSTAPLQQARDQADQTQAIAQLAGQYGLVYFYRGGDPIDAQMAG
VVADFARTRHVALIPVSMDGQVSPQVPDSRPDGGQSARMGISHYPALFLVDPASKDYRPL
AYGFMTQDDLAKRFLNVATGFKPNF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatgagagcactgttactggccgccgtgatggcgtgtgcgctgccggcgtttgcggac
gggccgccgccggcggatgaggtggtggatccggccgacccgttcaccggctggcactgg
tacaacgagccgaagaaaaaggcggaaacgcccgcgccgaagccccggcccacacagcag
gtgccggacttcagccggttgtcacccggcgagcaggccgacgtgctgaagggctacacg
aaggaggcgctgaacaacgccatcctgcacccgtcggcggagaacacggcgacgttcctg
cgctggcagaagttctggaccgaccgggcctcgatgttcagccagtcgttcgcggtggcg
cagctgcatcatccggacctcgattacaacctcgagcatccgcactacaacagcaccgcg
ccgctgcagcaggcccgcgaccaggcggaccagacgcaggccatcgcgcagctcgccggc
cagtacgggctggtgtacttctaccgcggcggcgacccgattgatgcgcagatggcgggc
gtggtggcggactttgcgcgtacccgtcacgtcgcgctcatcccggtcagcatggacggt
caggtttcaccgcaggtgccggacagccggcccgacggcgggcagagcgcgcggatgggc
atcagccactatccggccctgtttctggtcgacccggcatcaaaagactaccgcccgctg
gcctacggctttatgacgcaggacgacctggcgaagcggttcctcaacgtggccaccggc
tttaagccgaacttttaa

DBGET integrated database retrieval system