KEGG   Escherichia coli BL21(DE3): ECD_00306Help
Entry
ECD_00306         CDS       T00931                                 

Gene name
mhpE
Definition
(GenBank) 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase, class I
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl00360  Phenylalanine metabolism
ebl00362  Benzoate degradation
ebl00621  Dioxin degradation
ebl00622  Xylene degradation
ebl01100  Metabolic pathways
ebl01120  Microbial metabolism in diverse environments
ebl01220  Degradation of aromatic compounds
Module
ebl_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ECD_00306 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECD_00306 (mhpE)
   00622 Xylene degradation
    ECD_00306 (mhpE)
   00621 Dioxin degradation
    ECD_00306 (mhpE)
Enzymes [BR:ebl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     ECD_00306 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: ACT42205
UniProt: A0A140NFK3
Position
343403..344416
Genome map
AA seq 337 aa AA seqDB search
MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDAHVDSIEVAHGDGLQGSSFNYG
FGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGARVVRVATHCTEADVSA
QHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCIYVVDSGGAMNMSDIRDR
FRALKAVLKPETQTGMHAHHNLSLGVANSIEAVEEGCDRIDASLAGMGAGAGNAPLEVFI
AAADKLGWQHGTDLYALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHCETAAA
RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtaaaaaactttatatctcggacgtcacgttgcgtgacggtatgcacgccatt
cgtcatcagtattcgctggaaaacgttcgccagattgccaaagcactggacgatgcccac
gtggattcgattgaagtggcccacggcgacggtttgcagggttccagctttaactatggt
ttcggcgcacatagcgaccttgaatggattgaagcagcggcggatgtggtgaagcacgcc
aaaatcgcgacgttgttgctgccaggaatcggcactattcacgatctgaaaaatgcctgg
caagctggcgcgcgggtggttcgtgtggctacgcactgtaccgaagctgatgtttccgcc
cagcatattcagtatgcccgcgagctcggaatggacaccgttggttttctgatgatgagc
catatgaccacgccagagaatctcgcaaagcaggcaaagctgatggaaggctacggtgcg
acctgtatttatgtggtggattctggcggtgcgatgaacatgagcgatatccgtgaccgt
ttccgcgccctgaaagcagtgttgaaaccagaaacgcaaaccggcatgcacgctcaccat
aacctgagtcttggcgtggcgaactctatcgaggcggtggaagagggctgcgaccgaatc
gacgccagcctcgcgggaatgggcgcgggcgcaggtaacgcgccgctggaagtatttatt
gccgccgcggataaactgggctggcagcatgggaccgatctctatgcgttaatggatgcc
gctgacgacctggtgcgtccgttgcaggatcgaccggtacgagtcgatcgcgaaacgctg
gcgctgggatacgctggtgtttactccagcttcctgcgtcactgtgaaacggcggcggcg
cgttatggcttaagcgcggtggatattctcgttgagctgggcaaacgccggatggttggc
ggccaggaggatatgatcgtcgacgtggcgctggatctgcgcaacaacaaataa

DBGET integrated database retrieval system