KEGG   Escherichia coli BL21(DE3): ECD_02657Help
Entry
ECD_02657         CDS       T00931                                 

Gene name
rlmM
Definition
(GenBank) 23S rRNA C2498 2'-O-ribose methyltransferase, SAM-dependent
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ebl  Escherichia coli BL21(DE3)
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ebl03009]
    ECD_02657 (rlmM)
Enzymes [BR:ebl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ECD_02657 (rlmM)
Ribosome biogenesis [BR:ebl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECD_02657 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 MIT_C
Motif
Other DBs
NCBI-ProteinID: ACT44473
UniProt: C5W8B2
Structure
PDB: 

Position
complement(2778423..2779523)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELP
FSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFC
RKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgtattgctgtgccgtccggggtttgaaaaagagtgcgccgcagaaatt
accgataaagccggccagcgggaaattttcggttttgcccgcgtgaaagagaatgcgggt
tatgtcatttatgaatgttatcaacctgatgatggcgataagttaatccgtgagctgccg
ttcagttcattaatttttgcccgccagtggtttgtggtgggggaactcctgcagcatttg
ccgccagaagatcgtattacccccattgtcggcatgttacagggtgtagtagagaagggc
ggtgaactgcgtgttgaagttgccgataccaacgaaagcaaagagttgctgaaattctgc
cgtaaattcaccgtgccgctacgcgctgccttgcgcgatgctggggtgctggcgaactat
gaaacgccgaagcgtccggttgtgcatgtattctttattgcaccaggctgctgctatacc
ggttactcatacagcaacaataattcgccgttctatatgggcattccgcgcctgaaattt
ccggcagatgcgccgagtcgttccacactcaaactggaagaggcatttcatgtgtttatt
cctgcggatgagtgggatgaacgcctggcgaacgggatgtgggcggtggatttaggcgct
tgccctggcggctggacctaccaactggtgaagcgcaacatgtgggtttattccgtcgac
aacggcccgatggcgcaaagtctgatggataccggacaggtgacgtggctgcgggaagac
ggtttcaaattccgtccgacgcgcagcaatatctcctggatggtatgcgatatggttgaa
aaaccggcgaaagttgcggcattgatggcgcagtggctggttaatggctggtgtcgtgaa
accattttcaacctcaaactgccgatgaaaaaacgctacgaagaagtgtcacacaatctg
gcgtatattcaggcacagcttgatgaacatggcataaatgctcagattcaggcgcggcag
ttgtatcacgatcgcgaagaagtgacggtgcacgtccgccgcatctgggctgcggtgggt
ggtcgtcgcgacgagcgataa

DBGET integrated database retrieval system